Conserved Protein Domain Family
PRK06823

?
PRK06823: PRK06823 
ornithine cyclodeaminase; Validated
Statistics
?
PSSM-Id: 136070
View PSSM: PRK06823
Aligned: 18 rows
Threshold Bit Score: 475.417
Threshold Setting Gi: 34498704
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26989909    1 MRVFSKAQIVAHFNPELAVSQLEEGFIAYSEGKVQVPPVQGFAFKGANGDCCVKSAYIEGSPTFTVKLSTGFYDNPSKGL 80
gi 148547743   1 MRVFSKAQIIARFNPELAVSQLEEGFIAYSEGKVQVPPVQGFAFKGANGDCCVKSAYIEGSPTFTVKLSTGFYDNPSKGL 80
gi 170721848   1 MKVFSKQQVTAGLDMELAVQCLEEGFIAFSQGKVQVPPVQAFAFPQANGDCCIKSAHVEGSDTFTVKLSTGFYDNPSKGL 80
gi 34498704    1 MKLLDKNAIIARFDADHALARVKAGFIAYSRGQVQSAPVQNFHFAGANGDCCVKSAHIAGEEALVVKISTGFYDNPSRGL 80
gi 218931067   1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80
gi 45443721    1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80
gi 108808986   1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80
gi 108813894   1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80
gi 145597331   1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80
gi 294505618   1 MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFDQANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26989909   81 PSNDGLMLVLSAHTGQPLALLQDQGWLTAMRTALAGRIAARLLAPSQVKAIGILGTGMQAQMQLEQLRAVTDCRQVIVWG 160
gi 148547743  81 PSNDGLMLVLSAHTGQPLALLQDQGWLTAMRTALAGRIAARLLAPAQVKAIGILGTGMQAQMQLEQLRAVTDCRQVIVWG 160
gi 170721848  81 PSNDGLMLVASASTGQPLALLQDEGWLTCIRTALAGRIAARLLAPANVKAIGILGTGTQARMQLEQLGAVTPCRTVVVWG 160
gi 34498704   81 PSNDGLVLALSATDGRVLALLQDQGWLTTMRTALAGRLVAGLLAPSRVEAIGLLGAGEQARAQLEQLRAVTDCREVRVWS 160
gi 218931067  81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
gi 45443721   81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
gi 108808986  81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
gi 108813894  81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
gi 145597331  81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
gi 294505618  81 ASNQGVMMAFSAKTGEPQAILLDEGWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 26989909  161 RHERGLAAYTAFARELGFAVHSTQDAAEVAGAANLIVCTTPSRQALLHSDWVQPGTHITAVGADAPGKQELDPALVARAD 240
gi 148547743 161 RHERGLAAYTAFARELGFGVHSTQDAAEVAGAANLIVCTTPSRQALLHSDWVQPGTHITAVGADAPGKQELDPALVARAD 240
gi 170721848 161 RGDAELAAYKTFANDLGYEVQVTRNAAEVAQAANLIVCATPSREPLLQSEWVQPGTHITAVGADAPGKQELDPALVARAD 240
gi 34498704  161 RQPEQAAAFCAFAAQLGFRALAAADPRAVAAEANLIVTATPSRGPLLQRGWIRPGTHITALGADGPGKQELDPAIAADAN 240
gi 218931067 161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
gi 45443721  161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
gi 108808986 161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
gi 108813894 161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
gi 145597331 161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
gi 294505618 161 RSETALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVGADSAGKHELSAELVARAD 240
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 26989909  241 RIIVDAIAQCSQYGEVAHALGCGRIDANQLIELGTLLAGRAKGREHDSQITLADLTGVAVQDAQVASHALAALCT 315
gi 148547743 241 RIIVDAIAQCSQYGEVAHALGSGQINAHQLIELGTLLAGRAKGREHDGQITLADLTGVAVQDAQIASYALAALCT 315
gi 170721848 241 RIIVDSLYQCSQYGEVSHALKAGLIVEQQLTELGALLEGRATGREHDAQITLADLTGVAVLDAQISSCVLASLAA 315
gi 34498704  241 VVVADSLAQCAAYGELSHAVKAGLLAPSRIVELGDALASGVRLRQNDEQITLADLTGIAAQDAAIAASVLAPGG- 314
gi 218931067 241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
gi 45443721  241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
gi 108808986 241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
gi 108813894 241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
gi 145597331 241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
gi 294505618 241 KILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGIPFRENDQQITLADLTGLGIQDVQIVKGILGDKKG 315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap