Conserved Protein Domain Family
PRK06904

?
PRK06904: PRK06904 
replicative DNA helicase; Validated
Statistics
?
PSSM-Id: 136106
View PSSM: PRK06904
Aligned: 5 rows
Threshold Bit Score: 934.411
Threshold Setting Gi: 152979092
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152979092   1 MARQPSQNLPQERDQQTAQVAIPPHSIEAEQAVLGAIMLNNRHWENVVERVIADDFYLAAHRIIFQEMENLTRQNQPIDL 80
gi 16273469   34 ISPMASQPQIKSSDKKTAQVSIPPHSTEAEQAVLGGIMLSNQHWDGIAERVIADDFYTFQHRLIFTEMEHLMRNQSPIDL 113
gi 68249840   34 ISPMASQPQIKSSDKKTAQVSIPPHSIEAEQAVLGGIMLSNQHWDGIAERVIADDFYTFQHRLIFTEMEHLMRNQSPIDL 113
gi 113461083   3 KATTGSNQSARIKDKKFEQTLIPPHSIEAEQAVLGGILLDNRYWDSVADQIIAEDFYTFEHRIIFQEIALLFAQNTPVDL 82
gi 170717658   3 KATTGSNQSARIKDKKFEQTLIPPHSIEAEQAVLGGILLDNRYWDSVADQIIAEDFYTFEHRIIFQEIALLFAQNTPVDL 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152979092  81 LTLDQALKNKGIIDDVGGFAYLAELSKNTPSAANINAYSDIVREKAILRDLIGVSNNIAQRAYSPKGKDVKEILDEAERD 160
gi 16273469  114 ITLDQALRSRGVSDEVGGFAYLAELSNNTPNAINILAYADIVREKAILRELISVGNRIAENSYSPKGQDIKLILDEAERE 193
gi 68249840  114 ITLDQALRSHGVSDEVGGFAYLAELSNNTPNAINILAYADIVREKAILRELISVGNRIAENSYSPKGQDIKLILDEAERE 193
gi 113461083  83 LVLDEVLKTKGKSEEVGGFAYLAELSNNTPSAANILTYAEIVREKAILRELISVGNNIVKNAYKPNGQAIKDILDNAERD 162
gi 170717658  83 LVLDEVLKTKGKSEEVGGFAYLAELSNNTPSAANILTYAEIVREKAILRELISVGNNIVKNAYKPNGQAIKDILDNAERD 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152979092 161 VFTIAEKRTTQNEGPENVVNILERTITKIETLKAMgAGNNGITGVTTGFVDLDKKTAGLQPSDLVIVAARPSMGKTTFAM 240
gi 16273469  194 VFAIAEKRTTSSEGPQNVINVLESTIEKIDILSKL-ENHSGVTGVTTGFTDLDKKTAGLQPSDLIIVAARPSMGKTTFAM 272
gi 68249840  194 VFAIAEKRTTSSEGPQNVINVLESTIEKIDILSKL-ENHSGVTGVTTGFTDLDKKTAGLQPSDLIIVAARPSMGKTTFAM 272
gi 113461083 163 IFSIAEKRTSANEGPQNVINLLFNTIDKIENLAAT-PTNNGVTGVSTGFTALDQKTSGLQKSDLIIVAARPSMGKTTFAM 241
gi 170717658 163 IFSIAEKRTSANEGPQNVINLLFNTIDKIENLAAT-PTNNGVTGVSTGFTALDQKTSGLQKSDLIIVAARPSMGKTTFAM 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152979092 241 NLCENAAMASDKPVLIFSLEMPADQIMMRTLASLSRVDQTAIRTGQIEDDGDWAKISSTVALLSEKSNMYIDDSAGLTPT 320
gi 16273469  273 NLCENAAMASEKPVLVFSLEMPAEQIMMRMIASLARVDQTKIRTGQNLDEIEWNKIASVVGMFKQKNNLFIDDSSGLTPT 352
gi 68249840  273 NLCENAAMASEKPVLVFSLEMPAEQIMMRMIASLARVDQTKIRTGQNLDEIEWNKIASVVGMFKQKNNLFIDDSSGLTPT 352
gi 113461083 242 NLCENAAMLSEKPVLVFSLEMPAEQILMRMLASLSRVDQVKIRTG-NLTQQDFAKISGTFGMFKQKPNLYIDDSSGLTPT 320
gi 170717658 242 NLCENAAMLSEKPVLVFSLEMPAEQILMRMLASLSRVDQVKIRTG-NLTQQDFAKISGTFGMFKQKPNLYIDDSSGLTPT 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152979092 321 ELRSRARRVYRERGGLSLIMVDYLQLMRAPGF-DNRTLEIAEISRSLKALAKELEVPVVALSQLNRTLENRTDKRPVNSD 399
gi 16273469  353 DVRSRARRVYRENGGLSMIMVDYLQLMRAPAFsDNRTLEIAEISRSLKALAKELQVPVVALSQLNRTLEQRGDKRPVNSD 432
gi 68249840  353 DVRSRARRVYRENGGLSMIMVDYLQLMRAPAFsDNRTLEIAEISRSLKALAKELQVPVVALSQLNRTLEQRADKRPVNSD 432
gi 113461083 321 ELRSRARRVYRENGGLSLIMVDYLQLMRAPGFeNNRTLEIAEISRSLKALAKELKVPVVALSQLNRTLENRGDRRPINSD 400
gi 170717658 321 ELRSRARRVYRENGGLSLIMVDYLQLMRAPGFeNNRTLEIAEISRSLKALAKELKVPVVALSQLNRTLENRGDRRPINSD 400
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 152979092 400 LRESGSIEQDADLIMFIYRDEVYHETTEEnKNVAEIIIGKQRNGPIGRVRLTFQGQYSRFDNYAGSLPFDDNY 472
gi 16273469  433 LRESGSIEQDADLIMFIYRDEVYNDNSED-KGVAEIIIGKQRNGPIGRVRLKFNGQFSRFDNLAEQREYRDDY 504
gi 68249840  433 LRESGSIEQDADLIMFIYRDEVYNDNSED-KGVAEIIIGKQRNGPIGRVRLKFNGQFSRFDNLAEQREYRDDY 504
gi 113461083 401 LRESGSIEQDADLIMFIYRDEVYNETTEDnKGIAEIIIGKQRNGPIGTVKLAFQGQYSRFDNLANIPQYYTK- 472
gi 170717658 401 LRESGSIEQDADLIMFIYRDEVYNETTEDnKGIAEIIIGKQRNGPIGTVKLAFQGQYSRFDNLANIPQYYTK- 472
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap