Conserved Protein Domain Family
PRK07045

?
PRK07045: PRK07045 
putative monooxygenase; Reviewed
Statistics
?
PSSM-Id: 136171
View PSSM: PRK07045
Aligned: 12 rows
Threshold Bit Score: 640.801
Threshold Setting Gi: 152985567
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116052232   1 MTDNHIDVLINGCGIGGAMLAYLLGRQGHRVVVVEQARRERAINGADLLKPAGIRVVEAAGLLAEVTRRGGRVRHELEVY 80
gi 15599385    1 MTDNHIDVLINGCGIGGAMLAYLLGRQGHRVVVVEQARRERAINGADLLKPAGIRVVEAAGLLAEVTRRGGRVRHELEVY 80
gi 152985567   1 MTDNHIDVLINGCGIGGAMLAYLLGRQGHRVVVVEQARRERAINGADLLKPAGIRVVEAAGLLAEVTRRGGRVRHELEVY 80
gi 218889481   1 MTDNHIDVLINGCGIGGAMLAYLLGRQGHRVVVVEQARRERAINGADLLKPAGIRVVEAAGLLAEVTRRGGRVRHELEVY 80
gi 161579038   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80
gi 126447065   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80
gi 124381862   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80
gi 53721855    1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80
gi 162210113   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80
gi 126444640   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80
gi 126458163   1 MKNNPVDVLINGSGIAGVALAHLLGARGHSVTVIERAARNRAQNGADLLKPSGIGVVRAMGLLDDVFAAGGLRRDAMRLY 80
gi 83717041    1 MKNNQVDVLINGSGIAGVALAHLLGTRGHGVTVVERAACHRAQNGADLLKPSGIGVVRKMGLLDDVIAAGGLRRDAMKLF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116052232  81 HDGELLRYFNYSSVDARGYFILMPCESLRRLVLEKIDGEATVEMLFETRIEAVQRDERHAIDQVRLNDGRVLRPRVVVGA 160
gi 15599385   81 HDGELLRYFNYSSVDARGYFILMPCESLRRLVLEKIDGEATVEMLFETRIEAVQRDERHAIDQVRLNDGRVLRPRVVVGA 160
gi 152985567  81 HDGELLRHFNYSSVDPRGYFILMPCESLRRLVLEKIDGEATVEMLFETRIEAVQRDERHAVGQVRLNDGRVLRPRVVVGA 160
gi 218889481  81 HDGELLRYFNYSSVDARGYFILMPCESLRRLVLEKIDGEATVEMLFETRIEAVQRDERHAIDQVRLNDGRVLRPRVVVGA 160
gi 161579038  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
gi 126447065  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
gi 124381862  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
gi 53721855   81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
gi 162210113  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
gi 126444640  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVTPTVLVGA 160
gi 126458163  81 HDKAPIASLDYRSASALGYFILIPCEQLRRLLLAKLDGLPNVRLRFETSIERIERDADGTVTSLTLSDGERVAPTVLVGA 160
gi 83717041   81 HDKELIASLDYRTSSALGFFILIPCEQLRRLLLAKLDVMPNVRLRFETSIERIEQDADGTVTSVVLSDGETVAPKALVGA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116052232 161 DGIASYVRRRLLDIEVERHPYPSPMLVGTFALAPCVAERNRLYVDAQGGLAYFYPIGFDRARLVVSFPREESRELMADTR 240
gi 15599385  161 DGIASYVRRRLLDIDVERRPYPSPMLVGTFALAPCVAERNRLYVDSQGGLAYFYPIGFDRARLVVSFPREEARELMADTR 240
gi 152985567 161 DGIASYVRRRLLDIEVERHPYPSPMLVGTFALAPCVAERNRLYVDSRGGLAYFYPIGFDRARLVVSFPREESRELMADTR 240
gi 218889481 161 DGIASYVRRRLLDIDVERRPYPSPMLVGTFALAPCVAERNRLYVDSQGGLAYFYPIGFDRARLVVSFPREEARELMADTR 240
gi 161579038 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADAT 240
gi 126447065 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADAT 240
gi 124381862 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADAT 240
gi 53721855  161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADTT 240
gi 162210113 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADTT 240
gi 126444640 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADTT 240
gi 126458163 161 DGARSMIRDDVLRMPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDQATRLVVSFPADEMQGYLADTT 240
gi 83717041  161 DGARSMIRSDVLRVPAERVPYATPMAFGTIALTDSVRECNRLYVDSNQGLAYFYPIGDEATRLVVSFPADDMQDYLADAT 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116052232 241 GESLRRRLQRFVGDESAEAIAAVTGTSRFKGIPIGYLNLDRYWADNVAMLGDAIHNVHPITGQGMNLAIEDASALADALD 320
gi 15599385  241 GESLRRRLQRFVGDESAEAIAAVTGTSRFKGIPIGYLNLDRYWADNVAMLGDAIHNVHPITGQGMNLAIEDASALADALD 320
gi 152985567 241 GESLRRRLQRFVGDESAEAIAAVTGTSRFKGIPIGYLNLDRYWAGNVAMLGDAIHNVHPITGQGMNLAIEDASALADALD 320
gi 218889481 241 GESLRRRLQRFVGDESAEAIAAVTGTSRFKGIPIGYLNLDRYWADNVAMLGDAIHNVHPITGQGMNLAIEDASALADALD 320
gi 161579038 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
gi 126447065 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
gi 124381862 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
gi 53721855  241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
gi 162210113 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
gi 126444640 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
gi 126458163 241 RTKLLARLNEFVGDESADAMAAIGAGTAFPLIPLGRMNLDRYHKRNAVLLGDAAHSIHPITGQGMNLAIEDAGELGACLD 320
gi 83717041  241 RAKLVARLSEFVGDESADAMAAIGAGTEFPLIPLGRMNLDRYHKRNVVVLGDAAHSIHPITGQGMNLAIEDAGELGECLD 320
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 116052232 321 LALRDACALEDALAGYQAERFPVNQAIVSYGHALATSLEDRQRFAGVFDTALQGSSRTPEALGGERSY 388
gi 15599385  321 LALRDACALEDALAGYQAERFPVNQAIVSYGHALATSLEDRQRFAGVFDTALQGSSRTPEALGGERSY 388
gi 152985567 321 LALRDACALEEALAGYQAERFPVNQAIVSYGHALATSLEDRQRFAGVFDTALQGSSRAPEALGGERSY 388
gi 218889481 321 LALRDACALEDALAGYQAERFPVNQAIVSYGHALATSLEDRQRFAGVFDTALQGSSRTPEALGGERSY 388
gi 161579038 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
gi 126447065 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
gi 124381862 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
gi 53721855  321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
gi 162210113 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
gi 126444640 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
gi 126458163 321 LHLSGQITLADALERFERIRRPVNEAVISYGHTLATTYHDRAALVANFRSQLQTSGRDAAWLGAAVEV 388
gi 83717041  321 QHLSGRIALADALDRFERIRHPVNEAVISYGHALATTYHDRAALVANFRSQLQTSGRDAALLGTAAEA 388
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap