Conserved Protein Domain Family
flgB

?
PRK07182: flgB 
flagellar basal body rod protein FlgB; Reviewed
Links
?
Statistics
?
PSSM-Id: 75964
View PSSM: PRK07182
Aligned: 11 rows
Threshold Bit Score: 234.393
Threshold Setting Gi: 108809058
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 170022968   1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLSTqmsstqms 80
gi 22127331    1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72
gi 218927909   1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72
gi 45442793    1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72
gi 162418530   1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72
gi 108809058   1 -------------MAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 59
gi 108810745   1 -------------MAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 59
gi 145597814   1 -------------MAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 59
gi 294502785   1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72
gi 51597640    1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72
gi 186896774   1 MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGVMAAPDRSSAQMLST-------- 72
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 170022968  81 saQMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 158
gi 22127331   73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
gi 218927909  73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
gi 45442793   73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
gi 162418530  73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
gi 108809058  60 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 135
gi 108810745  60 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 135
gi 145597814  60 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 135
gi 294502785  73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
gi 51597640   73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
gi 186896774  73 --QMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap