Conserved Protein Domain Family
PRK08181

?
PRK08181: PRK08181 
transposase; Validated
Statistics
?
PSSM-Id: 136670
View PSSM: PRK08181
Aligned: 18 rows
Threshold Bit Score: 496.759
Threshold Setting Gi: 146279516
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167621681   1 MKPADPIDAGRLTLALNELRLPAIKTIWPDFAVRADKEGWPAARFLAALTEHELAERASRRIQRHLDEARLPPGKTLDGF 80
gi 27380110   13 MSTTNVVDTARLNLLLNELRLPAIKALWPQFAEQSDKEGWPAARFLATIAEHEIAERGRRRIERHLVEARLPTGKTFDSF 92
gi 27378637   13 MSTTNVVDTARLNLLLNELRLPAIKALWPQFAEQSDKEGWPAARFLATIAEHEIAERGRRRIERHLVEARLPTGKTFDSF 92
gi 27377107   13 MSTTNVVDTARLNLLLNELRLPAIKALWPQFAEQSDKEGWPAARFLATIAEHEIAERGRRRIERHLVEARLPTGKTFDSF 92
gi 27377010   13 MSTTNVVDTARLNLLLNELRLPAIKALWPQFAEQSDKEGWPAARFLATIAEHEIAERGRRRIERHLVEARLPTGKTFDSF 92
gi 27376818   13 MSTTNVVDTARLNLLLNELRLPAIKALWPQFAEQSDKEGWPAARFLATIAEHEIAERGRRRIERHLVEARLPTGKTFDSF 92
gi 227818790   2 KNVHNTIDEARLGIMLNDLRLPTIKTLWPQFAEQADREGWPAARFLSAIAEHELAERAHRRIERHLAEAHLPPGKTLESF 81
gi 146279516   1 MSTSEPIDEARLGLLLGDLRLPTIKHIWPAFAERADKEGWPAARFLTALAEHEIAERARRRIERHLTEAHLPPGKTLDGF 80
gi 146276989   1 MSTSEPIDEARLGLLLGDLRLPTIKHIWPAFAERADKEGWPAARFLTALAEHEIAERARRRIERHLTEAHLPPGKTLDGF 80
gi 146276369   1 MSTSEPIDEARLGLLLGDLRLPTIKHIWPAFAERADKEGWPAARFLTALAEHEIAERARRRIERHLTEAHLPPGKTLDGF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167621681  81 DFDAVPTVSKAQVMALAAGDSWLDNGANLLMFGPPGGGKSHLAAALGLALVENGWRVFFTRTTDLVQRLQTARRDLQLEA 160
gi 27380110   93 DFEAVPMISKAQMTALAAGDGWLGKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELNLEG 172
gi 27378637   93 DFEAVPMISKAQMTALAAGDGWLGKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELNLEG 172
gi 27377107   93 DFEAVPMISKAQMTALAAGDGWLGKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELNLEG 172
gi 27377010   93 DFEAVPMISKAQMTALAAGDGWLGKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELNLEG 172
gi 27376818   93 DFEAVPMISKAQMTALAAGDGWLGKGANLLLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELNLEG 172
gi 227818790  82 AFDAVPMVSKAQVMAIAAGDSWLAKGANILLFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELQLES 161
gi 146279516  81 DFEAVPMLSKAQIMAMVAGDSWLEKGDNLLVFGPPGGGKSHLAAAIGLGLIENGWRVFFTRTTDLVQRLQVARRELALEQ 160
gi 146276989  81 DFEAVPMLSKAQIMAMVAGDSWLEKGDNLLVFGPPGGGKSHLAAAIGLGLIENGWRVFFTRTTDLVQRLQVARRELALEQ 160
gi 146276369  81 DFEAVPMLSKAQIMAMVAGDSWLEKGDNLLVFGPPGGGKSHLAAAIGLGLIENGWRVFFTRTTDLVQRLQVARRELALEQ 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167621681 161 AIAKLDKYHLLILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWGRIFPDQAMTLAAVDRLVHHATIFEMN 240
gi 27380110  173 AINRLDRFDLVILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWNKVFPDPAMTLAAIDRLVHHATIVEMN 252
gi 27378637  173 AINRLDRFDLVILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWNKVFPDPAMTLAAIDRLVHHATIVEMN 252
gi 27377107  173 AINRLDRFDLVILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWNKVFPDPAMTLAAIDRLVHHATIVEMN 252
gi 27377010  173 AINRLDRFDLVILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWNKVFPDPAMTLAAIDRLVHHATIVEMN 252
gi 27376818  173 AINRLDRFDLVILDDLAYVTKDQAETSVLFELISARYERRSLLITANQPFGEWNKVFPDPAMTLAAIDRLVHHATIVEMN 252
gi 227818790 162 AIAKLDKFDLLILDDLAYVTKDQAETSVLFELISARYERRSIMITANQPFGEWNRVFPDPAMTLAAVDRLVHHATIFEMN 241
gi 146279516 161 AIAKLDKYHLLILDDLAYVTKDQAETSALFELISARYERRSILITANQPFGEWNRIFPDPAMTLAAVDRLVHHATILELN 240
gi 146276989 161 AIAKLDKYHLLILDDLAYVTKDQAETSALFELISARYERRSILITANQPFGEWNRIFPDPAMTLAAVDRLVHHATILELN 240
gi 146276369 161 AIAKLDKYHLLILDDLAYVTKDQAETSALFELISARYERRSILITANQPFGEWNRIFPDPAMTLAAVDRLVHHATILELN 240
                        250       260
                 ....*....|....*....|....*....
gi 167621681 241 VESYRRRTAIERKRGPGRPLIRATIKTSA 269
gi 27380110  253 VESYRRRTALERKRGPGRPPEHATQKTLA 281
gi 27378637  253 VESYRRRTALERKRGPGRPPEHATQKTLA 281
gi 27377107  253 VESYRRRTALERKRGPGRPPEHATQKTLA 281
gi 27377010  253 VESYRRRTALERKRGPGRPPEHATQKTLA 281
gi 27376818  253 VESYRRRTALERKRGPGRPPEHATQKTLA 281
gi 227818790 242 VESYRRRSAMEAKRHRGRPAAFATTKSAS 270
gi 146279516 241 VESYRRRTALERKKGPGRPPTRATIKNTS 269
gi 146276989 241 VESYRRRTALERKKGPGRPPTRATIKNTS 269
gi 146276369 241 VESYRRRTALERKKGPGRPPTRATIKNTS 269
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap