Conserved Protein Domain Family
PRK08787

?
PRK08787: PRK08787 
peptide chain release factor 2; Provisional
Statistics
?
PSSM-Id: 136970
View PSSM: PRK08787
Aligned: 13 rows
Threshold Bit Score: 626.3
Threshold Setting Gi: 28198320
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21231300    1 MLEKTVIGIADVLAGLTDAGELLDLAESEQDEDTAVAVIADLDKYQAHVEKLEFQRMFSGQMDGANAFVDIQAGAGGTEA 80
gi 66768648    1 MLEKTVIGIADVLAGLTDAGELLDLAESEQDEDTAVAVIADLDKYQAHVEKLEFQRMFSGQMDGANAFVDIQAGAGGTEA 80
gi 188991534   1 MLEKTVIGIADVLAGLTDAGELLDLAESEQDEDTAVAVIADLDKYQAHVEKLEFQRMFSGQMDGANAFVDIQAGAGGTEA 80
gi 58582496   17 MLEKTVIGIADVLSGLVDAGDLLELAESEQDEDTALAVIADLDKYQTHVEKLEFERMFSGQMDGANAFVDIQAGAGGTEA 96
gi 84624384   17 MLEKTVIGIADVLSGLVDAGDLLELAESEQDEDTALAVIADLDKYQTHVEKLEFERMFSGQMDGANAFVDIQAGAGGTEA 96
gi 188575993  17 MLEKTVIGIADVLSGLVDAGDLLELAESEQDEDTALAVIADLDKYQTHVEKLEFERMFSGQMDGANAFVDIQAGAGGTEA 96
gi 21242619   17 MLEKTVIGIADVLSGLADAGDLLELAESEQDEDTAVAVIADLDNYQAHVEKLEFQRMFSGQMDGANAFVDIQAGAGGTEA 96
gi 78047471   62 MLEKTVIGIADVLSGLADAGDLLELAESEQDEDTALAVIADLDNYQAHVEKLEFQRMFSGQMDSANAFVDIQAGAGGTEA 141
gi 15837713   26 LLDKTVTGIAHVLNGVAEASEFLDLAEIEQDQEMLQAVLNDVDIYQLQVEKLEFQRMFSGKMDGANAFVDIQAGAGGTEA 105
gi 28198320    1 -----------MLNGVAEASEFLDLAEIEQDQEMLQAVLNDVDIYQLQVEKLEFQRMFSGKMDGANAFVDIQAGAGGTEA 69
gi 170729664  26 LLDKTVTGIAHVLNGVAEASEFLDLAEIEQDQEMLQAVLNDVDIYQLQVEKLEFQRMFSGKMDGANAFVDIQAGAGGTEA 105
gi 182680959   1 -----------MLNGVAEASEFLDLAEIEQDQEMLQAVLNDVDIYQLQVEKLEFQRMFSGKMDGANAFVDIQAGAGGTEA 69
gi 194365600  62 SLEKTVGGIASVLDGLADATELLELAESEQDEDTALAVVADLDKHQAHVEKLEFQRMFSGEMDNAAAFVDIQAGAGGTEA 141
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21231300   81 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATIRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 160
gi 66768648   81 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATIRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 160
gi 188991534  81 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATIRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 160
gi 58582496   97 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATVRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 176
gi 84624384   97 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATVRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 176
gi 188575993  97 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATVRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 176
gi 21242619   97 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATVRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 176
gi 78047471  142 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATVRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 221
gi 15837713  106 QDWAEMLLRMYLRWAEGRGWKAELLEVSGGEVAGIKSATFRVEGDFAYGWLKTETGVHRLVRKSPFDSDNRRHTSFTSVF 185
gi 28198320   70 QDWAEMLLRMYLRWAEGRGWKAELLEVSGGEVAGIKSATFRVEGDFAYGWLKTETGVHRLVRKSPFDSDNRRHTSFTSVF 149
gi 170729664 106 QDWAEMLLRMYLRWAEGRGWKAELLEVSGGEVAGIKSATFRVEGDFAYGWLKTETGVHRLVRKSPFDSDNRRHTSFTSVF 185
gi 182680959  70 QDWAEMLLRMYLRWAEGRGWKAELLEVSGGEVAGIKSATFRVEGDFAYGWLKTETGVHRLVRKSPFDSDNRRHTSFTSVF 149
gi 194365600 142 QDWAEILLRMYLRWCESRGWKTELMEVSGGDVAGIKSATLRVEGDYAYGWLKTETGVHRLVRKSPFDSDNRRHTSFTSVF 221
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21231300  161 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 240
gi 66768648  161 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 240
gi 188991534 161 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 240
gi 58582496  177 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 256
gi 84624384  177 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 256
gi 188575993 177 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 256
gi 21242619  177 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 256
gi 78047471  222 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 301
gi 15837713  186 VSPEVDDNIDIEINPADLKTDVYRSSGAGGQHVNKTESAVRITHVPSGIVVACQTERSQHANRDRAMKMLAAKLYESEIQ 265
gi 28198320  150 VSPEVDDNIDIEINPADLKTDVYRSSGAGGQHVNKTESAVRITHVPSGIVVACQTERSQHANRDRAMKMLAAKLYESEIQ 229
gi 170729664 186 VSPEVDDNIDIEINPADLKTDVYRSSGAGGQHVNKTESAVRITHVPSGIVVACQTERSQHANRDRAMKMLAAKLYESEIQ 265
gi 182680959 150 VSPEVDDNIDIEINPADLKTDVYRSSGAGGQHVNKTESAVRITHVPSGIVVACQTERSQHANRDRAMKMLAAKLYESEIQ 229
gi 194365600 222 VSPEIDDNIDITINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNIVVACQTGRSQHQNRDNAMKMLAAKLYELEIQ 301
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 21231300  241 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 313
gi 66768648  241 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 313
gi 188991534 241 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 313
gi 58582496  257 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 329
gi 84624384  257 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 329
gi 188575993 257 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 329
gi 21242619  257 KRNAEKDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 329
gi 78047471  302 KRNAEKDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 374
gi 15837713  266 KRNAEKDVLEASKSDIGWGSQIRNYVLDQSRIKDLRTGVERSDTQKVLDGDLDEFIEASLRAGLEAGAKRADA 338
gi 28198320  230 KRNAEKDVLEASKSDIGWGSQIRNYVLDQSRIKDLRTGVERSDTQKVLDGDLDEFIEASLKAGLEAGAKRADA 302
gi 170729664 266 KRNAEKDVLEASKSDIGWGSQIRNYVLDQSRIKDLRTGVERSDTQKVLDGDLDEFIEASLKAGLEAGAKRADA 338
gi 182680959 230 KRNAEKDVLEASKSDIGWGSQIRNYVLDQSRIKDLRTGVERSDTQKVLDGDLDEFIEASLKAGLEAGAKRADA 302
gi 194365600 302 KRNAEKDAVEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAVGSKRVDA 374
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap