Conserved Protein Domain Family
aroDE

?
PRK09310: aroDE 
bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed
Statistics
?
PSSM-Id: 137204
View PSSM: PRK09310
Aligned: 14 rows
Threshold Bit Score: 792.075
Threshold Setting Gi: 16751990
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62185307    1 MLCATISGPTFAEAKQQLLHSLPLVDSIELRIDCLlSLSSNELKHLVSLAKKPILTLRKHTSLSEIAWIERTLQLAELQP 80
gi 15605094    1 MLCTTISGPSFLEAKKQILRSLKECHCFEMRVDLL-SVSCLELKKLMELAPISILAWKKPESCSQADWIDKMQSLAELNP 79
gi 76789098    1 MLCTTISGPSFLEAKKQILRSLKECHCFEMRVDLL-SVSCLELKKLMELAPISILAWKKPESCSQADWIDKMQSLAELNP 79
gi 166155456   1 MLCTTISGPSFLEAKKQILRSLKECHCFEMRVDLL-SVSCLELKKLMELAPISILAWKKPESCSQADWIDKMQSLAELNP 79
gi 237802795   1 MLCTTISGPSFLEAKKQILRSLKECHCFEMRVDLL-SVSCLELKKLMELAPISILAWKKPESCSQADWIDKMQSLAELNP 79
gi 237804717   1 MLCTTISGPSFLEAKKQILRSLKECHCFEMRVDLL-SVSCLELKKLMELAPISILAWKKPESCSQADWIDKMQSLAELNP 79
gi 89898096    1 MLCATISGPTFAEAKQQLLQSLPLVDSIELRVDCLlSLSSNQLKHLISLAKKPILTLKKHASLSEIAWIERTMELAKLQP 80
gi 29840484    1 MLCATISGPSFFEAKQQLLHSLPFVDSIELRIDCLlSLSSDQLKHLVCLAKKPILTLRRHASLSEIAWVERTMELAKLQP 80
gi 16751990    1 MLCATVSGPSFCEAKQQILKSLHLVDIIELRLDLInELDDQELHTLITTAQNPILTFRQHKEMSTALWIQKLYSLAKLEP 80
gi 15618943    1 MLCATVSGPSFCEAKQQILKSLHLVDIIELRLDLInELDDQELHTLITTAQNPILTFRQHKEMSTALWIQKLYSLAKLEP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62185307   81 EYLDIDKDFPKEALAKIQKNYPKIKIILSYHSETSEHIPNLCKEMLRQQAHHYKIAITSTKSTDTLRCIQIKKHLPENTT 160
gi 15605094   80 NYLDLEKDFPEEDMIRIRQLHPQIKIIRSLHTSEHTDIIQLYAHMRSSAADYYKFAVSSSSTTDLLDICHQKRSLPENTT 159
gi 76789098   80 NYLDLEKDFPEEDMIRIRQLHPQIKIIRSLHTSEHTDIIQLYAHMRSSAADYYKFAVSSSSTTDLLDICHQKCSLPENTT 159
gi 166155456  80 NYLDLEKDFPEEDMIRIRQLHPQIKIIRSLHTSEHTDIIQLYAHMRSSAADYYKFAVSSSSTTDLLDICHQKRSLPENTT 159
gi 237802795  80 NYLDLEKDFPEEDMIRIRQLHPQIKIIRSLHTSEHTDIIQLYAHMRSSAADYYKFAVSSSSTTDLLDICHQKCSLPENTT 159
gi 237804717  80 NYLDLEKDFPEEDMIRIRQLHPQIKIIRSLHTSEHTDIIQLYAHMRSSAADYYKFAVSSSSTTDLLDICHQKCSLPENTT 159
gi 89898096   81 EYLDIDKDFPKEALTSIQKQYPNIKIILSYHSETSEYAPNLHEEMLKRQAHHYKIAITSTRSIDTLRCIQIKKNLPENTT 160
gi 29840484   81 DYLDIDKDFPKEALRKIRNQYPNIKIILSYHSQTSEHVPTLYNEMLKQQAHHYKIAITSTKSVDALRLIQIKKHLPENTT 160
gi 16751990   81 KWMDIDVSLPKTALQTIRKSHPKIKLILSYHTDKNEDLDAIYNEMLATPAEIYKIVLSPENSSEALNYIKKARLLPKPST 160
gi 15618943   81 KWMDIDVSLPKTALQTIRKSHPKIKLILSYHTDKNEDLDAIYNEMLATPAEIYKIVLSPENSSEALNYIKKARLLPKPST 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62185307  161 LLCMGNAGIASRILSPLMKNAINYASGIHAPKVAPGQLSIEDLLAYNYTNLSAEARIYGLIGNpVDRSISHLSHNKLFSE 240
gi 15605094  160 VVCLGGMGRPSRILSPILQNPFTYARSTGSSPVAPGQFSLKHHYFYNFASLSAQSPICALIGD-TSRSIGHLTHNPFFSQ 238
gi 76789098  160 VVCLGGMGRPSRILSPILQNPFTYARSTGSSPVAPGQFSLKHHYFYNFASLSAQSPICALIGD-TSRSIGHLTHNPFFSQ 238
gi 166155456 160 VVCLGGMGRPSRILSPILQNPFTYARSTGSSPVAPGQFSLKHHYFYNFASLSAQSPICALIGD-TSRSIGHLTHNPFFSQ 238
gi 237802795 160 VVCLGGMGRPSRILSPILQNPFTYARSTGSSPVAPGQFSLKHHYFYNFASLSAQSPICALIGD-TSRSIGHLTHNPFFSQ 238
gi 237804717 160 VVCLGGMGRPSRILSPILQNPFTYARSTGSSPVAPGQFSLKHHYFYNFASLSAQSPICALIGD-TSRSIGHLTHNPFFSQ 238
gi 89898096  161 LLCMGNAGIASRILSPLMKNAINYAAGINAPNVAPGQLSIADLLAYNYTNLSAESSIYGLIGNpVNRSISHLSHNKLFSE 240
gi 29840484  161 VLCMGNEGIASRILSPLMKNAINYASGIHAPKVAPGQLSIEDLLAYNYANLSSEARIYGLIGNpIDRSISHLSHNKLFSE 240
gi 16751990  161 VLCMGTHGLPSRVLSPLISNAMNYAAGISAPQVAPGQPKLEELLSYNYSKLSEKSHIYGLIGDpVDRSISHLSHNFLLSK 240
gi 15618943  161 VLCMGTHGLPSRVLSPLISNAMNYAAGISAPQVAPGQPKLEELLSYNYSKLSEKSHIYGLIGDpVDRSISHLSHNFLLSK 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62185307  241 LQLNMSYIKILLAPYELNEFFSLTRDLPFGGLSVTMPFKTAVLEYIDILDPSVQQCQSCNTLVFHNNKIAGYNTDGLGLL 320
gi 15605094  239 LGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTLVIRQGEIEGHDTDGEGLF 318
gi 76789098  239 LGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTLVIRQGEIEGHDTDGEGLF 318
gi 166155456 239 LGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTLVIRQGEIEGHDTDGEGLF 318
gi 237802795 239 LGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTLVIRQGEIEGHDTDGEGLF 318
gi 237804717 239 LGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTLVIRQGEIEGHDTDGEGLF 318
gi 89898096  241 LQIHASYIKILLDSHELKDFFSLTRDLPFQGLSVTMPFKTKVLDYIDILDHSAQHCQSCNTLVFNNHKITGYNTDGLGLF 320
gi 29840484  241 LHMKTSYIKILLSSADLKEFFSLTRDLPFGGLSVTMPFKTDVLDYIDVFDPSVKHCQSCNTLVFNKNKITGHNTDGLGLL 320
gi 16751990  241 LSLNATYIKFPVTIGEVVTFFSAIRDLPFSGLSVTMPLKTAIFDHVDALDASAQLCESINTLVFRNQKILGYNTDGEGVA 320
gi 15618943  241 LSLNATYIKFPVTIGEVVTFFSAIRDLPFSGLSVTMPLKTAIFDHVDALDASAQLCESINTLVFRNQKILGYNTDGEGVA 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62185307  321 NLLKRKNIPLQNMHVGIVGSGGAAKAIATTFAYSGAQISIFNRTKAHAEKLSVLCHGQAFPLHSLSeHHNIDILILCLP- 399
gi 15605094  319 SVLMQHQIPLNNQRVAIIGAGGAAQSIATRLSRANCELLIFNRTKAHAEDLASRCQAKAFSLEELP-LHRVSLIINCLP- 396
gi 76789098  319 SVLMQHQIPLNNQRVAIIGAGGAAQSIATRLSRANCELLIFNRTKAHAEDLASRCQAKAFSLEELP-LHRVSLIINCLP- 396
gi 166155456 319 SVLMQHQIPLNNQRVAIIGAGGAAQSIATRLSRANCELLIFNRTKAHAEDLASRCQAKAFSLEELP-LHRVSLIINCLPp 397
gi 237802795 319 SVLMQHQIPLNNQRVAIIGAGGAAQSIATRLSRANCELLIFNRTKAHAEDLASRCQAKAFSLEELP-LHRVSLIINCLP- 396
gi 237804717 319 SVLMQHQIPLNNQRVAIIGAGGAAQSIATRLSRANCELLIFNRTKAHAEDLASRCQAKAFSLEELP-LHRVSLIINCLP- 396
gi 89898096  321 NLLKRKHISLQNQHIAIVGSGGAAKAIATTLAREETRISIFNRTQAHAEKLARLCNGQAFPLSSLSeNHNIDMLVLCLP- 399
gi 29840484  321 NLLKRKNIAVHNTHVGIVGSGGAAKAIATTFAYSGACISIFNRTEENGKKLAELCNGNAFPLSSLSeKHAIDILILCLP- 399
gi 16751990  321 KLLKQKNISVNNKHIAIVGAGGAAKAIAATLAMQGANLHIFNRTLSSAAALATCCKGKAYPLGSLEnFKTIDIIINCLP- 399
gi 15618943  321 KLLKQKNISVNNKHIAIVGAGGAAKAIAATLAMQGANLHIFNRTLSSAAALATCCKGKAYPLGSLEnFKTIDIIINCLP- 399
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 62185307  400 -PGVDIPEIYPPVIIDINTLPKESLYTKKAKERGCQILYGYEMFAEQALLQFSLWFPDKLSQENRERFRLSVENIISTM 477
gi 15605094  397 -PSCTIPKAVAPCVVDINTIPKHSTFTQYARSQGSSIIYGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAAVLASLF 474
gi 76789098  397 -PSCTIPKAVAPCVVDINTIPKHSTFTQYARSQGSSIIYGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAAVLASLF 474
gi 166155456 398 sPSCTIPKAVAPCVVDINTIPKHSAFTQYARSQGSSIIYGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAAVLASLF 476
gi 237802795 397 -PSCTIPKAVAPCVVDINTIPKHSTFTQYARSQGSSIIYGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAAVLASLF 474
gi 237804717 397 -PSCTIPKAVAPCVVDINTIPKHSTFTQYARSQGSSIIYGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAAVLASLF 474
gi 89898096  400 -PHVEIPEIFPPVIIDINALPKESLYIQKAKNHGSRVLYGYEMFAEQALLQFSLWFPKQLSEYDCERFRSNVESIVNAV 477
gi 29840484  400 -PHVKIPEIFPPVVIDINTLPKESPYTRKAKAQGCHVLYGYEMFAEQALLQFSLWFPRSLSQDDSERFRINVENIVNTM 477
gi 16751990  400 -PEVTFPWRFPPIVMDINTKPHPSPYLERAQKHGSLIIHGYEMFIEQALLQFALWFPDFLTPESCDSFRNYVKNFMAKV 477
gi 15618943  400 -PEVTFPWRFPPIVMDINTKPHPSPYLERAQKHGSLIIHGYEMFIEQALLQFALWFPDFLTPESCDSFRNYVKNFMAKV 477
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap