Conserved Protein Domain Family
emrE

?
PRK09541: emrE 
multidrug efflux protein; Reviewed
Statistics
?
PSSM-Id: 137367
View PSSM: PRK09541
Aligned: 30 rows
Threshold Bit Score: 180.934
Threshold Setting Gi: 50121906
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15830868    1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80
gi 16128526    1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80
gi 170080124   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80
gi 209400746   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGLFG 80
gi 209917769   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80
gi 218694205   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80
gi 238899820   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80
gi 253774471   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYGIWSGVGIVLISLLLWGFFG 80
gi 254793994   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGLFG 80
gi 254160610   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYGIWSGVGIVLISLLLWGFFG 80
                         90       100       110
                 ....*....|....*....|....*....|
gi 15830868   81 QRLDLPAVIGMMLICAGVLVINLLSRSTPH 110
gi 16128526   81 QRLDLPAIIGMMLICAGVLIINLLSRSTPH 110
gi 170080124  81 QRLDLPAIIGMMLICAGVLIINLLSRSTPH 110
gi 209400746  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
gi 209917769  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
gi 218694205  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
gi 238899820  81 QRLDLPAIIGMMLICAGVLIINLLSRSTPH 110
gi 253774471  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
gi 254793994  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
gi 254160610  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap