Conserved Protein Domain Family
PRK09629

?
PRK09629: PRK09629 
bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional
Statistics
?
PSSM-Id: 104071
View PSSM: PRK09629
Aligned: 3 rows
Threshold Bit Score: 1186.07
Threshold Setting Gi: 66043826
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71734600   1 MSAFNGLSLVIEPNDLLERLDAPELILVDLTSSARYEAGHIRGARFVDPKRTQLGKPPAPGLLPDTADLQQLFGELGHNP 80 
66043826   1 MSAFTGLSLVIEPNDLLERLDAPELILVDLTSSARYEAGHIRGARFVDPKRTQLGTPPAPGLLPDTAGLEQVFGELGHNP 80 
28872069   1 MSAFTGLSLVIEPNDLLERLDAPELILVDLTSSARYEAGHIRGARFVDPKRTQLGKPPAPGLLPDTADLEQLFGELGHNP 80 
71734600  81 DAVYVVYDDEGGGWAGRFIWLLDVIGHHHYHYLDGGVLAWEAQSLPLSTDVAPVAGGPVTLTLHDEPTATREYLQSRLGA 160
66043826  81 DAVYVVYDDEGGGWAGRFIWLLDVIGHSRYHYLDGGLLAWEAQLLPLSTDVPPAADTPVTLTLHDEPTATREYLQSRLGA 160
28872069  81 DAVYVVYDDEGGGWAGRFIWLLDVIGHSGYHYLDGGVLAWEAQALPLSTEVPPVAGGPVALTLHDEPTATREYLQSRLGA 160
71734600 161 ADLAIWDARGPTEYSGEKVVAAKGGHIPGAVNFEWTAGMDKARNLRIRQDMPEILRDLGITPDKEVITHCQTHHRSGFTY 240
66043826 161 ADLAIWDARAPTEYSGEKVVAAKGGHIPGAVNFEWTAGMDKARNLRIRQDMPEILRDLGITPDKEIITHCQTHHRSGFTY 240
28872069 161 DDLAIWDARAPTEYSGEKVVAAKGGHIPGAVNFEWTAGMDKARNLRIRQDMPQILQDLGITPDKEVITHCQTHHRSGFTY 240
71734600 241 LVAKALGYPRVKAYAGSWSEWGNHPETPVELPEVAAAPAEAVEVAQPVAPAQPAPAETVEPVRSSEPRQASQKY-----S 315
66043826 241 LVAKALGYPRVKAYAGSWGEWGNHPDTPVEVPNVAAAPVEAVEVAQPAEPAQPAPAETVEPVRATEPGRTSQKY-----S 315
28872069 241 LVAKALGYPRVKAYAGSWGEWGNHPDTPVEVPTVAVAPIETAEVIEPAAPVQ--PAGTIEPVRATEWSKGSQKFsghssS 318
71734600 316 GHSSSGPSMKDRLFIISQYLLPHHLLSRLAGCVAECRVRWFKNAFTAWFARRYQVDMSQALVEDMTSYEHFNAFFTRALK 395
66043826 316 GHSSSGPSMKDRLFIISQYLLPHHLLSRLAGCVAECRVRWFKNAFTAWFARSYQVDMSQALVEDLTSYEHFNAFFTRALK 395
28872069 319 GHSSSGPSMKDRLFILSQHLLPHHLLSRLAGCVAECRVRWFKNAFTAWFARRYQVDMSQALVEDLTSYEHFNAFFTRALK 398
71734600 396 ADARPLDTTPGAILSPADGAISQLGPIDHGRIFQAKGHSFSVLELLGGDPKLSAPFMGGEFATVYLSPKDYHRVHMPLAG 475
66043826 396 ADARPLDATPGAILSPADGAISQLGPIDHGRIFQAKGHSFSVLELLGGDPKLSAPFMGGEFATVYLSPKDYHRVHMPLAG 475
28872069 399 ADARPMDTTPGAILSPADGAISQLGPIDHGRIFQAKGHSFSVLELLGGDPKLSAPFMGGEFATVYLSPKDYHRVHMPLAG 478
71734600 476 TLREMVYVPGRIFSVNQTTAENVPELFARNERVVCLFDTERGPMAVVLVGAMIVASVETVWAGLVTPPKRELKTFSYDEA 555
66043826 476 TLREMVYVPGRIFSVNQTTAENVPELFARNERVVCLFDTERGPMAVVLVGAMIVASVETVWAGLVTPPKRELKTFSYDEA 555
28872069 479 TLREMVYVPGRIFSVNQTTAENVPELFARNERVVCLFDTERGPMAVVLVGAMIVASVETVWAGLVTPPKRELKTFSYDEA 558
71734600 556 ARAPIHLEKGAEMGRFKLGSTAIVLFGPNQVKWAEQLTAGSKVQMGQALAVPTQA 610
66043826 556 ARAPIHLEKGAEMGRFKLGSTAIVLFGPGQVKWAEQLTAGSKVQMGQALAVPAQA 610
28872069 559 ARAPIHLEKGAEMGRFKLGSTAIVLFGPNQVKWAEQLTAGSKVQMGQALAAPAQA 613
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap