Conserved Protein Domain Family
PRK09649

?
PRK09649: PRK09649 
RNA polymerase sigma factor SigC; Reviewed
Statistics
?
PSSM-Id: 137458
View PSSM: PRK09649
Aligned: 11 rows
Threshold Bit Score: 291.944
Threshold Setting Gi: 183983052
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31793252    2 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 81
gi 15827760    1 MIASSGDEAVTDLALAAARGSKRALEAFIKATQQDVWRFVAYLSDVGNADDLTQETFLRAIGAIERFSGHSSGRTWLLAI 80
gi 221230237   1 MIASSGDEAVTDLALAAARGSKRALEAFIKATQQDVWRFVAYLSDVGNADDLTQETFLRAIGAIERFSGHSSGRTWLLAI 80
gi 15609206    2 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 81
gi 148823283 128 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 207
gi 148661883   2 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 81
gi 253798874 128 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 207
gi 183983052   1 MTTSPDDEAVTALALAAADGDARAFEAFIKATQQDVWRFVAYLSDAGSADDLTQETFLRAIGAIRRFGGRSSARTWLLAI 80
gi 118617811   3 MTTSPDDEAVTALALAAADGDARAFEAFIKATQQDVWRFVAYLSDAGSADDLTQETFLRAIGAIRRFGGRSSARTWLLAI 82
gi 121637954   2 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 81
gi 224990448   2 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31793252   82 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 161
gi 15827760   81 ARRVVADHIRRAQTRPRTTFDGYPERMLNADRHARGFEDLVEVTTMIANLATEQREALLLTQLLGLPYADAAAVCGCPVG 160
gi 221230237  81 ARRVVADHIRRAQTRPRTTFDGYPERMLNADRHARGFEDLVEVTTMIANLATEQREALLLTQLLGLPYADAAAVCGCPVG 160
gi 15609206   82 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 161
gi 148823283 208 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 287
gi 148661883  82 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 161
gi 253798874 208 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 287
gi 183983052  81 ARRVVADHIRHLQARPRAAHGVDPELLLDRGRRARGFEDLVEVTTMIAQLTSDQREALLLTQLLGLSYTDAAAVCGCPVG 160
gi 118617811  83 ARRVVADHIRHLQARPRAAHGVDPELLLDRGRRARGFEDLVEVTTMIAQLTSDQREALLLTQLLGLSYTDAAAVCGCPVG 162
gi 121637954  82 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 161
gi 224990448  82 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 161
                        170       180
                 ....*....|....*....|....
gi 31793252  162 TIRSRVARARDALLADAEPDDLTG 185
gi 15827760  161 TIRSRVARARDALLADTEHNHLTG 184
gi 221230237 161 TIRSRVARARDALLADTEHNHLTG 184
gi 15609206  162 TIRSRVARARDALLADAEPDDLTG 185
gi 148823283 288 TIRSRVARARDALLADAEPDDLTG 311
gi 148661883 162 TIRSRVARARDALLADAEPDDLTG 185
gi 253798874 288 TIRSRVARARDALLADAEPDDLTG 311
gi 183983052 161 TIRSRVARARDALLADNERDDLTG 184
gi 118617811 163 TIRSRVARARDALLADNERDDLTG 186
gi 121637954 162 TIRSRVARARDALLADAEPDDLTG 185
gi 224990448 162 TIRSRVARARDALLADAEPDDLTG 185
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap