Conserved Protein Domain Family
PRK09677

?
PRK09677: PRK09677 
putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional
Statistics
?
PSSM-Id: 137467
View PSSM: PRK09677
Aligned: 5 rows
Threshold Bit Score: 305.647
Threshold Setting Gi: 126175083
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129973    3 LKLAKRYGLCGFIRLVRDVLLTRVFYRNCRIIRFPCYIRNDGSINFGENFTSGVGLRLDAFG-----RGVIFFSDNVQVN 77
gi 170081663   3 LKLAKRYGLCGFIRLVRDVLLTRVFYRNCRIIRFPCYIRNDGSINFGENFTSGVGLRLDAFG-----RGVIFFSDNVQVN 77
gi 126175083   1 -MRVRGYNLSGILYLVFCFCYTKCFYKQSRLIRLPFRTRQFSKIKGMVGFTTGVDCRIDVFT-----NAKLEIGDDVQIN 74
gi 218708287   1 MNLFKSYGVMGVMRLIRDVVFTKLFNARCRIIRYPFYIRGAKHISFSKGFTSGVGLRLDTFEinanqTPKLSFGINCQVN 80
gi 238901223   3 LKLAKRYGLCGFIRLVRDVLLTRVFYRNCRIIRFPCYIRNDGSINFGENFTSGVGLRLDAFG-----RGVIFFSDNVQVN 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16129973   78 DYVHIASIESVTIGRDTLIASKVFITDHNHGSFKHSDPMSSPNIPPDMRTLESSAVVIGQRVWLGENVTVLPGTIIGNGV 157
gi 170081663  78 DYVHIASIESVTIGRDTLIASKVFITDHNHGSFKHSDPMSSPNIPPDMRTLESSAVVIGQRVWLGENVTVLPGTIIGNGV 157
gi 126175083  75 DNVHIACAEYIKIGKNTLIASKVYLTDHDH-------DFTSGKLKPIDWPLKSEPLIIGDNCWIGENVCILKGVSIGDGC 147
gi 218708287  81 DYVHIGCIESIEIGDDVLIASKVFITDHNHGDLDEPTDFL---LPPSKRGLTSKKVKIGNQTWIGESVMILPGVSIGNNC 157
gi 238901223  78 DYVHIASIESVTIGRDTLIASKVFITDHNHGSFKHSDPMSSPNIPPDMRTLESSAVVIGQRVWLGENVTVLPGTIIGNGV 157
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 16129973  158 VVGANSVVRGSIPENTVIAGVPAKIIKKYNHETKLWE 194
gi 170081663 158 VVGANSVVRGSIPENTVIAGVPAKIIKKYNHETKLWE 194
gi 126175083 148 IVGANAVVTKSFPNGVIIAGNPAKIIRFR-------- 176
gi 218708287 158 IIGAGSVVTKNIPDYSVAVGNPAKVIKIFDVERNDWK 194
gi 238901223 158 VVGANSVVRGSIPENTVIAGVPAKIIKKYNHETKLWE 194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap