Conserved Protein Domain Family
PRK09702

?
PRK09702: PRK09702 
PTS system arbutin-specific transporter subunit IIB; Provisional
Statistics
?
PSSM-Id: 77355
View PSSM: PRK09702
Aligned: 2 rows
Threshold Bit Score: 331.291
Threshold Setting Gi: 56480418
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56480418   1 MFSNHADMMLTQIAIGLCFTLLYFVVFRTLILQFNMCTPGREDAEVKLYSKAEYKASRGQTTAAEPKKELDQAAGILQAL 80
gi 30064993   1 MFSNHADMMLTQIAIGLCFTLLYFVVFRTLILQFNMCTPGREDAEVKLYSKAEYKASRGQTTAAEPKKELDQAAGILQAL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56480418  81 GGVGNISSINNCATRLRIALHDMSQTLDDEVFKKLGAHGVFRSGDAIQVIIGLHVSQLREQLDSLINSHQSAENVAITEA 160
gi 30064993  81 GGVGNISSINNCATRLRIALHDMSQTLDDEVFKKLGAHGVFRSGDAIQVIIGLHVSQLREQLDSLINSHQSAENVAITEA 160

                .
gi 56480418 161 V 161
gi 30064993 161 V 161
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap