Conserved Protein Domain Family
focB

?
PRK09713: focB 
putative formate transporter; Provisional
Statistics
?
PSSM-Id: 137485
View PSSM: PRK09713
Aligned: 20 rows
Threshold Bit Score: 447.585
Threshold Setting Gi: 260845122
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15803015    1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80
gi 15832608    1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80
gi 209397824   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80
gi 254794437   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80
gi 291283712   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80
gi 170683125   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLTVIADAPSSQALTHLVGGLCFTLGFIL 80
gi 218700949   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLTVIADAPSSQALTHLVGGLCFTLGFIL 80
gi 260856586   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80
gi 260869181   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80
gi 82777871    1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15803015   81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
gi 15832608   81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
gi 209397824  81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
gi 254794437  81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
gi 291283712  81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
gi 170683125  81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
gi 218700949  81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
gi 260856586  81 LAVCGTNLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
gi 260869181  81 LAVCGTNLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
gi 82777871   81 LAVCGTNLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15803015  161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
gi 15832608  161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
gi 209397824 161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
gi 254794437 161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
gi 291283712 161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
gi 170683125 161 TESVSLGIMCNVMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADH 240
gi 218700949 161 TESVSLGIMCNVMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADH 240
gi 260856586 161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
gi 260869181 161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
gi 82777871  161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTPFWQLAHSSADN 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 15803015  241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQES 282
gi 15832608  241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQES 282
gi 209397824 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQES 282
gi 254794437 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQES 282
gi 291283712 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQES 282
gi 170683125 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQEP 282
gi 218700949 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQEP 282
gi 260856586 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSMCYRAIYLRQES 282
gi 260869181 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSMCYRAIYLRQES 282
gi 82777871  241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQEL 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap