Conserved Protein Domain Family
PRK09744

?
PRK09744: PRK09744 
DNA-binding transcriptional regulator DicC; Provisional
Statistics
?
PSSM-Id: 137503
View PSSM: PRK09744
Aligned: 33 rows
Threshold Bit Score: 144.721
Threshold Setting Gi: 218705069
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 16129528   1 MLKTDALLYFGSKTKLAQAAGIRLASLYSWkGDLVPEGRAMRLQEASGGELQYDPKVYDEYRKTKRAGRLNNENHS 76
gi 170682538  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-GELVPEGRAMRLQEASGGELQYDPKVYDEYRKAKRAGRLNNENHP 75
gi 209400538  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-GELVPEGRAMRLQEASGGELQYDPKVYDEYRKAKRAGRLNNENHP 75
gi 209396753  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-GELVPEGRAMRLQEASGGELQYDPKVYDEYRKAKRAGRLNNENHP 75
gi 215486345  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-GELVPEGRAMRLQEASGGELQYDPKVYDEYRKAKRAGRLNNENHP 75
gi 260843555  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-GELVPEGRAMRLQEASGGELQYDPKVYDEYRKAKRAGRLNNENHP 75
gi 260855309  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-QELVPEGRAMRLQEASGGELLYDPKVYDEYRKTKRAGRLNNENHS 75
gi 260868063  1 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-QELVPEGRAMRLQEASGGELLYDPKVYDEYRKTKRAGRLNNENHS 75
gi 218705069 10 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-QELVPEGRAMRLQEASGGELLYDPKVYDEYRKTKRAGRLNNENHS 84
gi 218694782 10 MFKSDVINFYGTKAKVAKAAGVDPSAVSQW-QELVPEGRAMRLQEASGGELLYDPKVYDEYRKTKRAGRLNNENHS 84
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap