Conserved Protein Domain Family
PRK09903

?
PRK09903: PRK09903 
putative transporter YfdV; Provisional
Statistics
?
PSSM-Id: 104216
View PSSM: PRK09903
Aligned: 35 rows
Threshold Bit Score: 516.513
Threshold Setting Gi: 15802914
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15832506    1 MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREMIFADTRLTLVSLVVIVGCFF 80 
74312920    1 MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREMIFADTRLTLVSLVVIVGCFF 80 
82777776    1 MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREMIFADTRLTLVSLVVIVGCFF 80 
82544840    1 MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREMIFADTRLTLVSLVVIVGCFF 80 
91211715    1 MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREMIFADTRLTLVSLVVIVGCFF 80 
110642561   1 MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREMIFADTRLTLVSLVVIVGCFF 80 
110806325   1 MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREMIFADTRLTLVSLVVIVGCFF 80 
117624590   1 MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREMIFADTRLTLVSLVVIVGCFF 80 
157161845   1 MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREMIFADTRLTLVSLVVIVGCFF 80 
253772719   1 MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREMIFADTRLTLVSLVVIVGCFF 80 
15832506   81 FSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPIYGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKK 160
74312920   81 FSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPIYGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKK 160
82777776   81 FSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPIYGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKK 160
82544840   81 FSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPIYGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKK 160
91211715   81 FSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPIYGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKK 160
110642561  81 FSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPIYGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKK 160
110806325  81 FSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPIYGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKK 160
117624590  81 FSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPIYGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKK 160
157161845  81 FSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPIYGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKK 160
253772719  81 FSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPIYGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKK 160
15832506  161 NSNLSALISAAKEPVVWAPVLATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL 240
74312920  161 NSNLSALISAAKEPVVWAPVLATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL 240
82777776  161 NSNLSALISAAKEPVVWAPVLATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL 240
82544840  161 NSNLSALISAAKEPVVWAPVLATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL 240
91211715  161 NSNLSALISAAKEPVVWAPVLATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL 240
110642561 161 NSNLSALISAAKEPVVWAPVLATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL 240
110806325 161 NSNLSALISAAKEPVVWAPVLATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL 240
117624590 161 NSNLSALISAAKEPVVWAPVLATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL 240
157161845 161 NSNLSALISAAKEPVVWAPVLATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL 240
253772719 161 NSNLSALISAAKEPVVWAPVLATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL 240
15832506  241 MPLALLLVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFVVTAPLWIYVSRLVS 314
74312920  241 MPLALLLVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFVVTAPLWIYVSRLVS 314
82777776  241 MPLALLLVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFVVTAPLWIYVSRLVS 314
82544840  241 MPLALLLVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFVVTAPLWIYVSRLVS 314
91211715  241 MPLALLLVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFVVTAPLWIYVSRLVS 314
110642561 241 MPLALLLVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFVVTAPLWIYVSRLVS 314
110806325 241 MPLALLLVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFVVTAPLWIYVSRLVS 314
117624590 241 MPLALLLVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFVVTAPLWIYVSRLVS 314
157161845 241 MPLALLFVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFVVTAPLWIYVSRLVS 314
253772719 241 MPLALLFVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFVVTAPLWIYVSRLVS 314
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap