Conserved Protein Domain Family
PRK09979

?
PRK09979: PRK09979 
putative rho operon leader peptide; Provisional
Statistics
?
PSSM-Id: 77522
View PSSM: PRK09979
Aligned: 26 rows
Threshold Bit Score: 40.0208
Threshold Setting Gi: 15804372
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30
                ....*....|....*....|....*....|...
gi 15804372   1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33
gi 218707418  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33
gi 253775593  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33
gi 254163726  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33
gi 260846442  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33
gi 260857812  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33
gi 260870507  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33
gi 291285197  1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33
gi 74314296   1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33
gi 82779037   1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap