Conserved Protein Domain Family
PRK09982

?
PRK09982: PRK09982 
universal stress protein UspD; Provisional
Statistics
?
PSSM-Id: 137627
View PSSM: PRK09982
Aligned: 37 rows
Threshold Bit Score: 271.11
Threshold Setting Gi: 110807784
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15804512    1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80
gi 218692207   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80
gi 218701374   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80
gi 218707547   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80
gi 254795923   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80
gi 291285336   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80
gi 82778908    1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80
gi 91213464    1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80
gi 110644259   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80
gi 117626190   1 MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSELYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWP 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15804512   81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
gi 218692207  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
gi 218701374  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
gi 218707547  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
gi 254795923  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
gi 291285336  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
gi 82778908   81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
gi 91213464   81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
gi 110644259  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
gi 117626190  81 KTKLRIERGEMPETLLEIMQKEQCDLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK 142
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap