Conserved Protein Domain Family
PRK11383

?
PRK11383: PRK11383 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 105206
View PSSM: PRK11383
Aligned: 36 rows
Threshold Bit Score: 265.357
Threshold Setting Gi: 238897026
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152972433   1 MENKHATYSPAFHLISWIALIGGIVTYLVGLWNADMQLNEKGYYFAVLVLGLFAAASYQKTVRDKYEAIPTTALYYTTCL 80
gi 26250204    2 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 81
gi 110643810   1 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 80
gi 91213076    2 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 81
gi 117625845   1 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 80
gi 218560638   1 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 80
gi 218702329   1 MDNKISTYSPAFSIVSWIALVGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTSIYYMTCL 80
gi 215488847   1 MDNKISTYSPAFSIVSWVALIGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTPIYYMTCL 80
gi 288933061   1 MENKHATYSPAFHLISWIALIGGIVTYLVGLWNADMQLNEKGYYFAVLVLGLFAAASYQKTVRDKYEAIPTTALYYTTCL 80
gi 238897026   2 MENKHATYSPAFHLISWITLIGGIVTYLVGLWNADMQLNEKGYYFAVLVLGLFAAASYQKTVRDKYEAIPTTALYYTTCL 81
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 152972433  81 VVFVIAVGLLVIGLWNATLLLSEKGFYGLAYFLSLFGAVAVQKNVRDV-WDPTRLREplsVTEEGPET 147
gi 26250204   82 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIRDAgINPPKETQ---VTQEEYSE 146
gi 110643810  81 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIRDAgINPPKETQ---VTQEEYSE 145
gi 91213076   82 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIHDAgINPPKETQ---VTQEEYSE 146
gi 117625845  81 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIHDAgINPPKETQ---VTQEEYSE 145
gi 218560638  81 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIHDAgINPPKETQ---VTQEEYSE 145
gi 218702329  81 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIRDAgINPPKETQ---VTQEEYSE 145
gi 215488847  81 TVFIISVALLLVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIRDAgINPPKETQ---VTQEEYSE 145
gi 288933061  81 VVFVIAVGLLVIGLWNATLLLSEKGFYGLAYFLSLFGAVAVQKNVRDA-WDPTRLREplsVTEEGPES 147
gi 238897026  82 VVFVIAVGLLVIGLWNATLLLSEKGFYGLAYFLSLFGAVAVQKNVRDV-WDPTRLREplsVTEEGPET 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap