Conserved Protein Domain Family
PRK11401

?
PRK11401: PRK11401 
putative endoribonuclease L-PSP; Provisional
Statistics
?
PSSM-Id: 105214
View PSSM: PRK11401
Aligned: 36 rows
Threshold Bit Score: 240.353
Threshold Setting Gi: 218706737
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157148685   1 MRKIIATQHAPGAIGPYVQGVDLGSMVLTSGQIPVCPQTGEVAENVVDQARQSLENVKAIVEAAGLKVGDIVKTTVFITD 80
gi 291284489  22 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 101
gi 254163057   1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80
gi 260845927   1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80
gi 170018634   1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80
gi 56480265    1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80
gi 30064456    1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80
gi 110806995  22 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 101
gi 82545371   22 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 101
gi 187732750   1 MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITD 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 157148685  81 LNDFTTINEVYQQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRGD 129
gi 291284489 102 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 150
gi 254163057  81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
gi 260845927  81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
gi 170018634  81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
gi 56480265   81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
gi 30064456   81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
gi 110806995 102 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 150
gi 82545371  102 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 150
gi 187732750  81 LNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA 129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap