Conserved Protein Domain Family
flgD

?
PRK11911: flgD 
flagellar basal body rod modification protein; Provisional
Statistics
?
PSSM-Id: 138812
View PSSM: PRK11911
Aligned: 9 rows
Threshold Bit Score: 213.546
Threshold Setting Gi: 289433974
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16802738    1 MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80
gi 46906947    1 MDGISSLSGAGQDTNNVVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80
gi 16799779    1 MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80
gi 116872085   1 MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80
gi 217965206   1 MDGISSLSGAGQDTNNVVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80
gi 226223327   1 MDGISSLSGAGQDTNNVVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80
gi 284801026   1 MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80
gi 284994168   1 MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80
gi 289433974   1 MDGISSLSGATQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQA 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 16802738   81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
gi 46906947   81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
gi 16799779   81 QNSALQSAVNFIGKDIKGVSLNGEVISGQVESVQQTTNGVMLKIKDQDSLVPMTYVTEIN 140
gi 116872085  81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
gi 217965206  81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
gi 226223327  81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
gi 284801026  81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
gi 284994168  81 QNSALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN 140
gi 289433974  81 QNSALQSAVNFIGKDIKGVSLNGEVISGQVESVQQTTNGVMLKLKEQDSLVPLTYVTEIN 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap