Conserved Protein Domain Family
PRK12269

?
PRK12269: PRK12269 
bifunctional cytidylate kinase/ribosomal protein S1; Provisional
Statistics
?
PSSM-Id: 105491
View PSSM: PRK12269
Aligned: 2 rows
Threshold Bit Score: 1820.09
Threshold Setting Gi: 15639271
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639271    1 MHGGGERERSFVHPRTRCVAVRARTVLQCRPMGTVIIALDGPAGSGKSSVCRLLASRLGAQCLNTGSFYRAFTLAALRRV 80
gi 189025513   1 MHGGGERERSFVHPRTRCVAVRARTVLQCRPMGTVIIALDGPAGSGKSSVCRLLASRLGAQCLNTGSFYRAFTLAALRRV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639271   81 SELAVQACSPSPDPDAAVGCAAVPHATNLDTSYAPLTAQKKVALFDEAYWVSFARTVALSYRAGVMYVGEENVESLLRSD 160
gi 189025513  81 SELAVQACSPSPDPDAAVGCAAVPHATNLDTSYAPLTAQKKVALFDEAYWVSFARTVALSYRAGVMYVGEENVESLLRSD 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639271  161 EVESAVSYFAAMPAIRAIMTGKIRSAVCGARVVCEGRDLTTVVFVDADLKCYLDASIEARVARRWAQGTSRLSKQELEQR 240
gi 189025513 161 EVESAVSYFAAMPAIRAIMTGKIRSAVCGARVVCEGRDLTTVVFVDADLKCYLDASIEARVARRWAQGTSRLSKQELEQR 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639271  241 MRARDAHDRARTVGGLRCAPDALYVDTSCLTIEEVCERIAREAHRRALWGGERSVENQEGKGTPLVPRQLQERYSFEAPE 320
gi 189025513 241 MRARDAHDRARTVGGLRCAPDALYVDTSCLTIEEVCERIAREAHRRALWGGERSVENQEGKGTPLVPRQLQERYSFEAPE 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639271  321 PGSVRMGTVVQVNAGTVFVDIGGKSEGRVPVEEFEAPPKAGDGVRVYVERVTPYGPELSKTKADRLGLKVKLRDAERDGT 400
gi 189025513 321 PGSVRMGTVVQVNAGTVFVDIGGKSEGRVPVEEFEAPPKAGDGVRVYVERVTPYGPELSKTKADRLGLKVKLRDAERDGT 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639271  401 PVEGRIVRLTEKKSGFEVDLGAGMMAFLPISQSDCQKVDAPESLIGLTSKFYIERISQSKQHRGNDNIVINRRRYLEERA 480
gi 189025513 401 PVEGRIVRLTEKKSGFEVDLGAGMMAFLPISQSDCQKVDAPESLIGLTSKFYIERISQSKQHRGNDNIVINRRRYLEERA 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639271  481 RQAREEFFNSVHIEDSVSGVVKSFTSFGAFIDLGGFDGLLHVNDMSWGHVARPREFVKKGQTIELKVIRLDQAEKRINLS 560
gi 189025513 481 RQAREEFFNSVHIEDSVSGVVKSFTSFGAFIDLGGFDGLLHVNDMSWGHVARPREFVKKGQTIELKVIRLDQAEKRINLS 560
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639271  561 LKHFQPDPWLEFENKFGVNDVVKGRVTKIADFGAFIELAEGIEGLAHISEFSWVKKTSKPSDMVKIGDEVECMILGYDIQ 640
gi 189025513 561 LKHFQPDPWLEFENKFGVNDVVKGRVTKIADFGAFIELAEGIEGLAHISEFSWVKKTSKPSDMVKIGDEVECMILGYDIQ 640
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639271  641 AGRVSLGLKQVTANPWEEIEARYPVGARFTRRIVKVTNAGAFIEMEEGIDGFLHVDDLSWVKRTRPADHELEVGKEIECM 720
gi 189025513 641 AGRVSLGLKQVTANPWEEIEARYPVGARFTRRIVKVTNAGAFIEMEEGIDGFLHVDDLSWVKRTRPADHELEVGKEIECM 720
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639271  721 VIECDPQARRIRLGVKQLSDNPWQVFANAYGVGSTVEGEVSSVTDFGIFVRVPGGVEGLVRKQHLVENRDGDPGEALRKY 800
gi 189025513 721 VIECDPQARRIRLGVKQLSDNPWQVFANAYGVGSTVEGEVSSVTDFGIFVRVPGGVEGLVRKQHLVENRDGDPGEALRKY 800
                        810       820       830       840       850       860
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 15639271  801 AVGDRVKAVIVDMNVKDRKVAFSVRDYQRKVQRDELSRYMSAPRGEDEGSFTLGDLMRQTSGK 863
gi 189025513 801 AVGDRVKAVIVDMNVKDRKVAFSVRDYQRKVQRDELSRYMSAPRGEDEGSFTLGDLMRQTSGK 863
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap