Conserved Protein Domain Family
PRK12279

?
PRK12279: PRK12279 
50S ribosomal protein L22/unknown domain fusion protein; Provisional
Statistics
?
PSSM-Id: 138835
View PSSM: PRK12279
Aligned: 3 rows
Threshold Bit Score: 492.283
Threshold Setting Gi: 26554460
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 170762229   1 MTNKVIQRNIHISHRKASLVIDLVRNKPVHEAIRILSNTPKKFAPIVLKLLNSAISNVQhNSKDMDPSKLYIYKIVANQG 80
gi 26554460    1 MQARAIQKNIHVSPRKAKLVCDLIRNKPVTNALSILENTNKKTAVFLKKLLHQAIANAT-NNHAMQADKLYVYHVVANQG 79
gi 209554129   1 MTNKVIQRNIHISHRKASLVIDLVRNKPVHEAIRILSNTPKKFAPIVLKLLNSAISNVQhNSKDMDPSKLYIYKIVANQG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 170762229  81 PTMKRTLPRAKGSADQLFKRTTHLEIVLSDDVNEREKELAAIKAK---------------------------KSKKPLAV 133
gi 26554460   80 STLKRTSPRAKGSADLIRKRHTHLEIVLSDDVNERNKEIQAIKDRikkraannkgywakqraaneaglkvveKPKKAKPA 159
gi 209554129  81 PTMKRTLPRAKGSADQLFKRTTHLEIVLSDDVNEREKELAAIKAK---------------------------KSKKPLVV 133
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 170762229 134 EPIAKVETKKVAKPSKVEIKPvEKDENVDPELLKREQQVLKVVE----KTASQKEEETTETIMISTSPKNAQVLF-DDLE 208
gi 26554460  160 QPKKPVEKKPQPKPEPKVVKE-EPVKPVKAESLKREQEVLKVVEtkpvEGAKKAKVEETAIIMISTKKEYADNLLnEELN 238
gi 209554129 134 EPVAKVETKKVAKPSKVETKPvEKDENVDPELLKREQQVLKVVE----KTASQKEEETTETIMISTSPKNAQVLF-DDLE 208
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 170762229 209 KNVIFYKTTPINKVLRVLVYVTSPTKKVVGEFDLESVEIGAISSIWRKYSKQSVISKKEYDAYYEGKDKAHALVSKKAYK 288
gi 26554460  239 KNVFFYKVTPVNPIKRVLIYTTTGKKGVVGEFDLDKIEILALSTAWKKYGQQSCMSKKDFDEYYKDSEKAHILISKEAFR 318
gi 209554129 209 KNVIFYKTTPVNKVLRVLVYVTSPTKKVVGEFDLESVEIGAISSIWRKYNKQSVISKKEYDAYYEGKDKAHALVSKKAYK 288
                        330       340
                 ....*....|....*....|...
gi 170762229 289 YRNPKDLSEYNMTKGPSGFQYLK 311
gi 26554460  319 YSRPKTLESYNMKKGPSGFQYLK 341
gi 209554129 289 YRNPKDLSEYNMTKGPSGFQYLK 311
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap