Conserved Protein Domain Family
PRK12320

?
PRK12320: PRK12320 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 138873
View PSSM: PRK12320
Aligned: 12 rows
Threshold Bit Score: 1184.4
Threshold Setting Gi: 41407676
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31793058    1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80
gi 118462986   1 MHILVTDATGALGRLVAGQLIAAGHTVTGIAELPHPCLDGNVEFVCAPLRDRVLRELTDEADAVIHLAPIDPTAPGNAAM 80
gi 41407676    1 MHILVTDATGALGRLVAGQLIAAGHTVTGIAELPHPCLDRNVEFVCAPLRDRVLRELTDEADAVIHLAPIDPTAPGNAAM 80
gi 15841337    1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80
gi 15609005    1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80
gi 148823079   1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80
gi 148661674   1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80
gi 253799088   1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80
gi 183982753   4 VHVLVTDAAGAIGRLVTRQLIAAGHTVSGISSHPHDYLDPNVDFVCASLRNPVLLELASEADAVIHLAPVEKGAPGAAGI 83
gi 118618399   1 MHVLVTDAAGAIGRLVTRQLIAAGHTVSGISSHPHDYLDPNVDFVCASLRNPVLLELASEADAVIHLAPVEKGAPGAAGI 80
gi 121637771   1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80
gi 224990255   1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRNPVLQELAGEADAVIHLAPVDTSAPGGVGI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31793058   81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
gi 118462986  81 DGLARVTDAAARAGSRLLFVSQAAGRPELYRPAEDLVASSWGPSVVVRIAPPVGRQLDWMVCRTVATVLRTKVSAQPMRV 160
gi 41407676   81 DGLARVTDAAARAGSRLLFVSQAAGRPELYRPAEDLVASSWGPSVVVRIAPPVGRQLDWMVCRTVATVLRTKVSAQPMRV 160
gi 15841337   81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
gi 15609005   81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
gi 148823079  81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
gi 148661674  81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
gi 253799088  81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
gi 183982753  84 TGLAHVSNAAARAGARLLFVSQAAGSPELYQQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLMRSKVSARPMRV 163
gi 118618399  81 TGLAHVSNAAARAGARLLFVSQAAGSPELYQQAETLVSTGWAPSSVIRIAPPVGRQLDWTVCRTVTTLMRSKVSARPMRV 160
gi 121637771  81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
gi 224990255  81 TGLAHVANAAARAGARLLFVSQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLRSKVSARPIRV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31793058  161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
gi 118462986 161 LHLDDLMRFLVTALDTDRTGVVDLASPDTVNLVTAWRMLRATDPRSRLHRVRSWSQLIPDLNVAAAQEDWLFEFGWHALD 240
gi 41407676  161 LHLDDLMRFLVTALDTDRTGVVDLASPDTVNLVTAWRMLRATDPRSRLHRVRSWSQLIPDLNVAAAQEDWLFEFGWHALD 240
gi 15841337  161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
gi 15609005  161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
gi 148823079 161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
gi 148661674 161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
gi 253799088 161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
gi 183982753 164 LHLDDLVRFLVLALDTDRNGVVDLATPDTTNVVTAWRLLGSVDPRLRPHRVQGWSQLIPEMDIAAAQEDWNFQYGWQATD 243
gi 118618399 161 LHLDDLVRFLVLALDTDRNGVVDLATPDTTNVVTAWRLLGSIDPRLRPHRVQGWSQLIPEMDIAAAQEDWNFQYGWQATD 240
gi 121637771 161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
gi 224990255 161 LHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLRSVDPHLRTRRVRSWEQLIPEVDIAAVQEDWNFEFGWQATE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31793058  241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
gi 118462986 241 AVADTARGLVGRRLDTAGAINHGAQLALPVEVLPQRA---GNGAHSAAPEGVEGEFDDRIDPRFPVFSATALTDALPGPL 317
gi 41407676  241 AVADTARGLVGRRLDTAGAINHGAQLALPVEVLPQRA---GNGAHSAAPEGVEGEFDDRIDPRFPVFSATALTEALPGPL 317
gi 15841337  241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
gi 15609005  241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
gi 148823079 241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
gi 148661674 241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
gi 253799088 241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
gi 183982753 244 AIVDTGRGLVGRRLDPAGATIGSAQLALPVEPTPRLTpadGTALDSAAPDGLEGEFDDRIDPRFPVFSAASLAEALPGPL 323
gi 118618399 241 AIVDTGRGLVGRRLDPAGATIGSAQLALPVEPTPRLTpadGTALDSAAPDGLEGEFDDRIDPRFPVFSAASLAEALPGPL 320
gi 121637771 241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
gi 224990255 241 AIVDTGRGLVGRRLHPAGATNGSGQLALPVEAPPRSVpshGEPLGSAAPEGLEGEFDDRIDERFPVFSSASLAEALPGPL 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31793058  321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
gi 118462986 318 TPITLDVQLSGLRTASRVLGRVLALGGAVGEEWDSRAIAVFGHRPYVGVSVNMVAATQLPGWDQDAVARDALVGRPQVGD 397
gi 41407676  318 TPITLDVQLSGLRTASRVLGRVLALGGAVGEEWDSRAIAVFGHRPYVGVSVNMVAATQLPGWDQDAVARDALVGRPQVGD 397
gi 15841337  321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
gi 15609005  321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
gi 148823079 321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
gi 148661674 321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
gi 253799088 321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
gi 183982753 324 TPMTLDVQMSGLRAAGRAMGQVLALGDVVAEEWGSRAIAVFGHRPYVGVSANLVAATQLPGWNERAVTQQALGGNTQVTE 403
gi 118618399 321 TPMTLDVQMSGLRAAGRAMGQVLALGDVVAEEWGSRAIAVFGHRPYVGVSANLVAATQLPGWNERAVTQQALGGNTQVTG 400
gi 121637771 321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
gi 224990255 321 TPMTLDVQLSGLRAAGRAMGRVLALGGVVADEWERRAIAVFGHRPYIGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31793058  401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
gi 118462986 398 PLPFGEPALAGGALGSIAKAVAAGRSVALLRHLRANTRDYCAAAVAEQVDAAQLALLPQAALEVRLRLLRDRIHQGWILN 477
gi 41407676  398 PLPFGEPALAGGALGSIAKAVAAGRSVALLRHLRANTRDYCAAAVAEQVDAAQLALLPQAALEVRLRLLRDRIHQGWILN 477
gi 15841337  401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
gi 15609005  401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
gi 148823079 401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
gi 148661674 401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
gi 253799088 401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
gi 183982753 404 LLPFGRPQLTGGPLRSAAKVLVTARSLSLLRHIRADTQAYVTAAADEHVGAEQLSTLPDASLEVRIRLLRDRIHQGWILT 483
gi 118618399 401 LLPFGRPQLTGGPLRSAAKVLVTARSLSLLRHIRADTQAYVTAAADEHVGAEQLSTLPDASLEVRIRLLRDRIHQGWILT 480
gi 121637771 401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
gi 224990255 401 LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLAAGQLASLPDAGLEVRIRLLRDRIHQGWILT 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31793058  481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
gi 118462986 478 ALWLLDTGITAAALVRSQAGQSVPGLGMITESGLVAAETAELAAMLAADPPLCALAADGNLASIRALAPKTAAAVDAAVA 557
gi 41407676  478 ALWLLDTGITAATLVRSQAGQSVPGLGMITESGLVAAETAELAAMLAADPPLCALAADGNLASIRALAPKTAAAVDAAVA 557
gi 15841337  481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
gi 15609005  481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
gi 148823079 481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
gi 148661674 481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
gi 253799088 481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
gi 183982753 484 ALWVIDTGVTAATLEHTRAGTSVSGVGVIMESGRIAAEIAALTEILRADAPLCALARDGNVDSIRALSASAAAALDATVA 563
gi 118618399 481 ALWVIDTGVTAATLEHTRAGTSVSGVGVIMESGRIAAETAALTEILRADAPLCALARDGNVDSIRALSASAAAALDATVA 560
gi 121637771 481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
gi 224990255 481 VLWVIDTGVTAATLEHTRAGSAVSGGGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASIRALSAPAAAAVDAVIA 560
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 31793058  561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
gi 118462986 558 RIGHRGPGDAELASQTFADDPAMLLSAAAAAAAAPAEPAAPATLAERLAANARGSKELAHDATMRFTHELRMTLRALGSL 637
gi 41407676  558 RIGHRGPGDAELASQTFGDDPAMLLSAAA--AAAPAEPAAPATLAERLAANARGSKELAHDATMRFTHELRMTLRALGSL 635
gi 15841337  561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
gi 15609005  561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
gi 148823079 561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
gi 148661674 561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
gi 253799088 561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHDTTIRFTHELRMTLRELGSR 640
gi 183982753 564 RLAHRGCGEAELANPSFGDDPALLLTAAAKAAAAPATPAAAPTLSQRLAASARGSRELAHDTTIRFTHDLRMTLRELASR 643
gi 118618399 561 RLAHRGCGEAELANPSFGDDPALLLTAAAKAAAAPATPAAAPTLSQRLAASARGSRELAHDTTIRFTHDLRMTLRELASR 640
gi 121637771 561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHGTTIRFTHELRMTLRELGSR 640
gi 224990255 561 RIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAHPATLIQRLAAGTRSARELAHGTTIRFTHELRMTLRELGSR 640
                        650       660       670       680       690
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 31793058  641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
gi 118462986 638 RVEADLIDAVDDVYYLTCNELVTMPGDARLRIKRRRTERERLQVQCPPEVIDGRWTPPQ 696
gi 41407676  636 RVEADLIDAVDDVYYLTCNELVTMPGDARLRIKRRRTERERLQVQCPPEVIDGRWTPPQ 694
gi 15841337  641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
gi 15609005  641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
gi 148823079 641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
gi 148661674 641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
gi 253799088 641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
gi 183982753 644 RVTADLMDTIDDVYYLTADELVTMPADARLRIKRRRTERERLQAQHPPEVIDGNWNPAL 702
gi 118618399 641 RVTADLMDTIDDVYYLTADELVTMPADARLRIKRRRTERERLQAQHPPEVIDGNWNPAL 699
gi 121637771 641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
gi 224990255 641 RVAADVIDVVDDVFYLTCDELITTPADARLRIKRRRAERERLQAQRPPDVIDHAWVPVE 699
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap