Conserved Protein Domain Family
PRK12339

?
PRK12339: PRK12339 
2-phosphoglycerate kinase; Provisional
Statistics
?
PSSM-Id: 105560
View PSSM: PRK12339
Aligned: 4 rows
Threshold Bit Score: 297.086
Threshold Setting Gi: 86741079
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741079   4 PETTIHIVYGIPCVGKSTGAVAFAHHRAIRTVVQTDYLREVQRAYVDLErvPVLAKVTHTAWELYGSPTQHNIVTGFADH 83
gi 16081833   1 MNSRIMFIGGVPGVGKTSISGYIARNTDIDIVLSSDYLREFLRPFAPQE--SHLETSVYDAWKFYGDMSDDNIIRGYLDQ 78
gi 13541683   1 MHSKIILIGGVPGVGKTSISGFLARELGIDIMLSGDYLREFLRPLFGDN--PLIQKSVYDAWQAYGQKTDENIVKGYIDQ 78
gi 48477551   1 ---MIVFIGGIPGVGKTSLSAYIARKKNIDIVLSGDYLREFLRSYLNDE---IMNVSVYDAWRFFGPMSNENVIKGYLYQ 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86741079  84 AAAIAPAIGQVVRKLVLDGFDAVVEGAHFHSPIIaalrDENRTAHIRATLLIVRTAEELRKRVAQKGRDRADGNPLKEWQ 163
gi 16081833  79 ARPIMGGINRVIARALANGEDLIIESLYFVPDMM----DEMVLKNAFLAYVYIDDPDLHRSRLEDRINYTHRNSPGSRLA 154
gi 13541683  79 AKIMMAGIDRILIRAIENGENLILETLYFLPEML----SEKARNNVHMFYLYIGDEKLHRDRLVDRINYTHKNSPGTRLA 154
gi 48477551  75 ARLMYNGYNKIISRALRNGESMVIESLYFDPGLF----DNDLFNKIKVFYIYISDIEIHRSRLLSRTMYTHKNDPGERLA 150
                       170       180       190       200
                ....*....|....*....|....*....|....*....|...
gi 86741079 164 DNIPFMLTIQDYLIADARGKDIEVSTADEWRRSWNPTDVPSST 206
gi 16081833 155 AHLKEYRTIMDYSMDMARGRGIGLYSTDDYALARQRLLDDFRK 197
gi 13541683 155 EHLYEYRNIMEYSMMRSSEYNVKIIDTSNYEEARRTILEMIVK 197
gi 48477551 151 EQLPVYKIMEDYSIKKCGDYNVKKIDNINFDETMELLGDLIE- 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap