Conserved Protein Domain Family
PRK12450

?
PRK12450: PRK12450 
foldase protein PrsA; Reviewed
Statistics
?
PSSM-Id: 138982
View PSSM: PRK12450
Aligned: 16 rows
Threshold Bit Score: 471.496
Threshold Setting Gi: 225868897
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15675810    1 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 80
gi 94991309    8 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 87
gi 94989370    9 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 88
gi 19746923    1 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 80
gi 94993261    9 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 88
gi 94995221    9 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 88
gi 71911545    1 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 80
gi 50915078    9 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 88
gi 139474495   1 MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAMLSLVISRVFETQYANKVSDKE 80
gi 195977800   1 MKKSTKLLAGIVTLASAMTLAACQSTNDNTSVITMKGDTISVSDFYNETKNTEISQRAMLNLVVSRVFEDQYGKKVSKKK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15675810   81 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 160
gi 94991309   88 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 167
gi 94989370   89 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTTEIMQFEKEE 168
gi 19746923   81 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 160
gi 94993261   89 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTTEIMQFEKEE 168
gi 94995221   89 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 168
gi 71911545   81 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 160
gi 50915078   89 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 168
gi 139474495  81 VEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLVEYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEE 160
gi 195977800  81 TEEAYNKSAEQYGASFSAALAQSGLTTDTYKRQIRSAMLVEYAVKEAAKKE-LTDADYKKAYESYTPEMTTQVITLDNEE 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15675810  161 DAKAALEAVKAEGADFAAIAKEKTTAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 240
gi 94991309  168 DAKAALEAVKAEGADFAAIAKEKTIAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 247
gi 94989370  169 DAKAALEAVKAEGADFAAIAKEKTIAADKKITYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 248
gi 19746923  161 DAKAALEAVKAEGADFAAIAKEKTTAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 240
gi 94993261  169 DAKAALEAVKAEGADFAAIAKEKTIAADKKITYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 248
gi 94995221  169 DAKAALEAVKAEGADFAAIAKEKTIAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPAISKRTYHIIKVT 248
gi 71911545  161 DAKAALEAVKAEGADFAAIAKEKTTAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT 240
gi 50915078  169 DAKAALEAVKAEGADFAAIAKEKTIAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPAISKRTYHIIKVT 248
gi 139474495 161 DAKAALEAVKAEGADFAAIAKEKTIAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPAISKRTYHIIKVT 240
gi 195977800 160 TAKAILGEVKAEGADFAAIAKEKTTAADKKVDYKFDSGDTKLPADVIKAASGLKEGDISEVVSVLDPATYQNKFYIVKVT 239
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 15675810  241 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 309
gi 94991309  248 QKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 316
gi 94989370  249 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 317
gi 19746923  241 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 309
gi 94993261  249 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 317
gi 94995221  249 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 317
gi 71911545  241 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 309
gi 50915078  249 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 317
gi 139474495 241 KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAKPNQKQPAQK 309
gi 195977800 240 KKAEKASDWKKYKKRLKEIVLAEKTQNIDFQNKVIAKALDKANVKIKDQAFANILAQYANTDKKASKAN 308
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap