Conserved Protein Domain Family
PRK12456

?
PRK12456: PRK12456 
Na(+)-translocating NADH-quinone reductase subunit E; Provisional
Statistics
?
PSSM-Id: 84141
View PSSM: PRK12456
Aligned: 10 rows
Threshold Bit Score: 307.295
Threshold Setting Gi: 51596259
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51596259    1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80
gi 22126260    9 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 88
gi 45441491    9 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 88
gi 108807313   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80
gi 145598482   1 MTESYFTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80
gi 153949214   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80
gi 162420222   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80
gi 170024487   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80
gi 186895293   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80
gi 218929049   1 MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51596259   81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
gi 22126260   89 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 168
gi 45441491   89 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 168
gi 108807313  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
gi 145598482  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
gi 153949214  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
gi 162420222  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
gi 170024487  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
gi 186895293  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
gi 218929049  81 FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG 160
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 51596259  161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
gi 22126260  169 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 207
gi 45441491  169 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 207
gi 108807313 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
gi 145598482 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
gi 153949214 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
gi 162420222 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
gi 170024487 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
gi 186895293 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
gi 218929049 161 LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap