Conserved Protein Domain Family
PRK12491

?
PRK12491: PRK12491 
pyrroline-5-carboxylate reductase; Reviewed
Statistics
?
PSSM-Id: 105695
View PSSM: PRK12491
Aligned: 13 rows
Threshold Bit Score: 451.063
Threshold Setting Gi: 217960549
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47528433    1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80
gi 30263087    1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80
gi 49185927    1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80
gi 30021221    1 MNKQIGFIGCGNMGIAMIGGMIKKNIVSPDQIICSDLNVINLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 80
gi 49480085    1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80
gi 52142392    1 MNKQIGFIGCGNMGIAMIGGMIKKNIVSPDQIICSDLNVINLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 80
gi 118478443   1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPDQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYSSVI 80
gi 218235333   1 ------------MGIAMIGGMIKKNIVFPDQIICSDLNVINLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 68
gi 217960549   1 ------------MGIAMIGGMIKKNIVSPDQIICSDLNVSNLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 68
gi 229600273   1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80
gi 222096609   1 MNKQIGFIGCGNMGIAMIGGMIKKNIVSPDQIICSDLNVINLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 80
gi 296503651   1 ------------MGIAMIGGMIKKNIVSPDQIICSDLNVINLKNASNEYGITITTNNNEVANSADILILSIKPDLYSSVI 68
gi 301054631   1 MNKQIGFIGCGNMGIAMIGGMINKNIVSPNQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILSIKPDLYTSVI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47528433   81 nqikNQIKNQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRVMPNTPVLVGEGMSALSFNEMVTEKDIKEVLNIFNSFGQ 160
gi 30263087   81 nqikNQIKNQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRVMPNTPVLVGEGMSALSFNEMVTEKDIKEVLNIFNSFGQ 160
gi 49185927   81 nqikNQIKNQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRVMPNTPVLVGEGMSALSFNEMVTEKDIKEVLNIFNSFGQ 160
gi 30021221   81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 156
gi 49480085   81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRIMPNTPVLVGEGMSALSFNEMVTEKDIKEVLTIFNIFGQ 156
gi 52142392   81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 156
gi 118478443  81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRVMPNTPVLVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 156
gi 218235333  69 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 144
gi 217960549  69 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 144
gi 229600273  81 nqikNQIKNQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRVMPNTPVLVGEGMSALSFNEMVTEKDIKEVLNIFNSFGQ 160
gi 222096609  81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 156
gi 296503651  69 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFGRKLKVVRVMPNTPALVGEGMSALCFNEMVTEKDIKEVLNIFNIFGQ 144
gi 301054631  81 ----NQIKDQIKNDVIVVTIAAGKSIKSTENEFDRKLKVIRIMPNTPVLVGEGMSALSFNEMVTEKDIKEVLTIFNIFGQ 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47528433  161 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 240
gi 30263087  161 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 240
gi 49185927  161 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 240
gi 30021221  157 TEVINEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPSGTT 236
gi 49480085  157 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 236
gi 52142392  157 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 236
gi 118478443 157 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMARKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 236
gi 218235333 145 TEVINEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 224
gi 217960549 145 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 224
gi 229600273 161 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 240
gi 222096609 157 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 236
gi 296503651 145 TEVINEKLMDVVTSISGSSPAYVYMFIEAMADAAVLGGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPSGTT 224
gi 301054631 157 TEVVNEKLMDVVTSISGSSPAYVYMFIEAMADAAVLDGMPRKQAYKFAAQAVLGSAKMVLETGIHPGELKDMVCSPGGTT 236
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 47528433  241 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSRLTSK 276
gi 30263087  241 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSRLTSK 276
gi 49185927  241 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSRLTSK 276
gi 30021221  237 IEAVVTLEEKGLRTAIISAMKRCTQKSMEMSSLTSK 272
gi 49480085  237 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSSLTSK 272
gi 52142392  237 IEAVVTLEEKGLRTAIISAMKRCMQKSMEMSSLTSK 272
gi 118478443 237 IEAVAILEAKGLRTAIISAMKRCTQKSMEMSSLTSK 272
gi 218235333 225 IEAVVTLEEKGLRTAIISAMKRCTQKSMEMSSLTSK 260
gi 217960549 225 IEAVVTLEEKGLRTAIISAMKRCMQKSMEMSSLTSK 260
gi 229600273 241 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSRLTSK 276
gi 222096609 237 IEAVVTLEEKGLRTAIISAMKRCMQKSMEMSSLTSK 272
gi 296503651 225 IEAVVTLEEKGLRTAIISAMKRCTQKSMEMSSLTSK 260
gi 301054631 237 IEAVATLEEKGLRTAIISAMKRCTKKSMEMSSLTSK 272
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap