Conserved Protein Domain Family
PRK12514

?
PRK12514: PRK12514 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 105710
View PSSM: PRK12514
Aligned: 5 rows
Threshold Bit Score: 302.51
Threshold Setting Gi: 89053139
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159185000   1 MQGTEIATLINRVGMGDRSAFVSLYQATSPKLFAICLKILRDRTEAEEALQEIYIKVWQRARTFAVSAGKPATWLATIAR 80
gi 89053139    2 TGPDHIEGLILQVSLGNRDAFSDLYDATSGKLFSICLKVLKNRSEAEDALQDAYMRIWNKADHYAVTGHSPMTWLITLTR 81
gi 13474039    1 MTPQDITKLIVRTSMKDRAAFDLLYRQTSAKLFGVCLRVLNDRGDAEEALQEVFVKIWTKADRFAVSDLSPISWLVAIAR 80
gi 99077920    6 TDTNDIENAIMRVGLGDRAAFSFLYDATSAKLFGVCLRVLGDRAEAEDTLQDVFVKVWHKADRYKANGYSPMTWLITLTR 85
gi 153009024   2 KQTDETSVLISKVALGDKDAFASLYKDTSPKLFAICLRILKDRSEAEEALQDVYIKIWKRSSTFGIGESVASAWLATIAR 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159185000  81 NHAIDTIRARKPASDDIDEAYDLVDESiRDPEQQVVLVDEGRRIDDCMRELETVHAQAVRRAYVEGLSYLELSDELRVPL 160
gi 89053139   82 NLAIDRLRKRRAVEVDLDEVGDITESR-PGPEAAAIAASEAGRIRACLEELPGDRAAAVRAAYLEGAAYKDLARHHDVPL 160
gi 13474039   81 NHAIDRVRARRKSAADIDAALEVADPA-PGPEAMVVAGDESQRIHHCLEELEKDRAAAVRGAYLKGESYAELAERHGVPL 159
gi 99077920   86 NTAIDRLRARKAGNVDIDDAHDLSDGS-PTPEAEAIASSERQRLNACFEELQADRSEAVRRAYLDGDSYKDLAARYDVPL 164
gi 153009024  82 NHSIDVIRARKPVTEDLDEIHDLADDVnPSPEKEVLARDEGRRIDDCMRELDQVHAKAVRQAYVEGLSYLELAQELQVPL 161
                        170       180
                 ....*....|....*....|
gi 159185000 161 NTVRTWLRRSLLKLRECMQR 180
gi 89053139  161 NTMRTWLRRSLLSLKECLSR 180
gi 13474039  160 NTMRTWLRRSLMKLRECLER 179
gi 99077920  165 NTMRTWLHRSLLTLKDCLSR 184
gi 153009024 162 NTVRTWLRRSLLKLRECMQR 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap