Conserved Protein Domain Family
PRK12525

?
PRK12525: PRK12525 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 139037
View PSSM: PRK12525
Aligned: 7 rows
Threshold Bit Score: 312.265
Threshold Setting Gi: 15597246
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116050040   2 DSQGSIKNTLIAQLFQQNYDWLCKKLSYQTGCSHSAEDLAAEAFLQVWMLPDPASIRSPRAFLATIAQRLMYESWRRKDL 81
gi 116050001   1 MGMDQTRNRLVGLMFQNDYSWLSGRLRRYLGCPHSAEDIASETFLKVLALPDPASIREPRALLTTIARRLMYDGWRRQDL 80
gi 15597289    2 DSQGSIKNTLIAQLFQQNYDWLCKKLSYQTGCSHSAEDLAAEAFLQVWMLPDPASIRSPRAFLATIAQRLMYESWRRKDL 81
gi 15597246    1 MGMDQTRNRLVGLMFQNDYSWLSGRLRRYLGCPHSAEDIASETFLKVLALPDPASIREPRALLTTIARRLMYDGWRRQDL 80
gi 218891993   1 MGMDQTRNRLVGLMFQNDYSWLSGRLRRYLGCPHSAEDIASETFLKVLALPDPASIREPRALLTTIARRLMYDGWRRQDL 80
gi 218891950   2 DSQGSIKNTLIAQLFQQNYDWLCKKLSYQTGCSHSAEDLAAEAFLQVWMLPDPASIRSPRAFLATIAQRLMYESWRRKDL 81
gi 77459348    1 MGSHNPHYQVIGQMFQKDYRWLCAAVSRTLGCPHSAQDIASETFLRVLALPDPLAIREPRALLTTIARRLVYEGWRRQDL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116050040  82 ERAYLQILAEAPEAVQPSPHEQWMLIESLQAIDRLLDGLSGQARAVFLMSQLEGLTYVQIGERLGLSLGRIHQLMKDALH 161
gi 116050001  81 ERAYLDSLAGLPEALAPSAEEQAQVVETLLRLERMLAGLSPKARAAFIHSQIGGLTYVEIAGLLEVSVSRIHQYMVEGFK 160
gi 15597289   82 ERAYLQILAEAPEAVQPSPHEQWMLIESLQAIDRLLDGLSGQARAVFLMSQLEGLTYVQIGERLGLSLGRIHQLMKDALH 161
gi 15597246   81 ERAYLESLAGLPEALAPSAEEQAQVVETLLRLERMLAGLSPKARAAFIHSQIGGLTYVEIACLLEVSVSRIHQYMVEGFK 160
gi 218891993  81 ERAYLESLAGLPEALAPSAEEQAQVVETLLRLERMLAGLSPKARAAFIHSQIGGLTYVEIAGLLEVSVSRIHQYMVEGFK 160
gi 218891950  82 ERAYLQILAEAPEAVQPSPHEQWMLIESLQAIDRLLDGLSGQARAVFLMSQLEGLTYVQIGERLGLSLGRIHQLMKDALH 161
gi 77459348   81 ERAYLQSLALAPEPVHPSPEERELVIETLLAVDRLLNGLSAKAKAAFLYHQLDGLTYSEIGERLGVSTSRVQQYMVEAFK 160

                 ....*...
gi 116050040 162 CCYRGFQE 169
gi 116050001 161 QCYQVLAE 168
gi 15597289  162 CCYRGFQE 169
gi 15597246  161 QCYQVLAE 168
gi 218891993 161 QCYQVLAE 168
gi 218891950 162 CCYRGFQE 169
gi 77459348  161 RCYQAMQA 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap