Conserved Protein Domain Family
PRK12531

?
PRK12531: PRK12531 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 105726
View PSSM: PRK12531
Aligned: 9 rows
Threshold Bit Score: 375.423
Threshold Setting Gi: 15642300
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642300    1 MFNPSPHTFGRQEWLECMEKVKSRDTQAFALVFSYYSPKLKQFVMKHVGSEQVALELVQETMSTVWQKASLFDGQKSSLA 80
gi 161501819   4 PVANSPSSMSKQDWAECMAKVKDKDKQAFAVVFQHFAPKLKQFAFKHVGNEQVAMEMVQETMTTVWHKAHLFDAEKSALS 83
gi 28899132    1 MMSDSPQKLGRNEWNAYMDKVKAKDREAFAFVFRFYAPKLKQFAYKHVGNEQVAMEMVQETMATVWQKAHLYDGKKSALS 80
gi 37680783    4 PVANSPSSMSKQDWAECMAKVKDKDKQAFAVVFQYFAPKLKQFAFKHVGNEQVAMEMVQETMTTVWHKAHLFDAEKSALS 83
gi 147673682   1 MFNPSPHTFGRQEWLECMEKVKSRDTQAFALVFSYYSPKLKQFVMKHVGSEQVALELVQETMSTVWQKASLFDGQKSSLA 80
gi 156975552   1 MMSESPQKLGRSEWNDYMDKVKARDKDAFAFVFRFYAPKLKQFAYKHVGNEQVAMEMVQETMATVWQKAHLYDGTKSALS 80
gi 229607130   1 MFNPSPHTFGRQEWLECMEKVKSRDTQAFALVFSYYSPKLKQFVMKHVGSEQVALELVQETMSTVWQKASLFDGQKSSLA 80
gi 227082426   1 MFNPSPHTFGRQEWLECMEKVKSRDTQAFALVFSYYSPKLKQFVMKHVGSEQVALELVQETMSTVWQKASLFDGQKSSLA 80
gi 262393473  14 MMSDSPKKLGRSDWNDYMDKVKARDKDAFAFVFRFYAPKLKQFAYKHVGNEQVAMEMVQETMATVWQKAHLYDGEKSALS 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15642300   81 TWIYTIARNLSYDLLRRQKGRDAYVLADDIWPEDYCPPDLVDHYAPEQDLLKEQVMKFLDRLPEAQQQVIKAVYLEEIPQ 160
gi 161501819  84 TWVYTIIRNLCFDLLRKQRGKDLHIHADDIWPSDYYPLDLVERYSPEQDMLKEQVMRFLDCLPKAQRDVLQAVYIEDLPH 163
gi 28899132   81 TWIYTIIRNLCFDLLRKQKGKELHIHSDDIWPSEYYPPDMVDHYSPEQDMLKEQVVKFLDILPKNQRDVLQAVYLEELPH 160
gi 37680783   84 TWVYTIIRNLCFDLLRKQRGKDLHIHADDIWPSDYYPLDLVERYSPEQDMLKEQVLRFLDCLPKAQRDVLQAVYIEDLPH 163
gi 147673682  81 TWIYTIARNLSYDLLRRQKGRDAYVLADDIWPEDYCPPDLVDHYAPEQDLLKEQVMKFLDRLPEAQQQVIKAVYLEEIPQ 160
gi 156975552  81 TWIYTIIRNLCFDLLRKQKGKDLHIHSDDIWPSDYYPPDLVDHYSPEQDMLKEQVVKFLDILPKNQREVLQAVYLQELPH 160
gi 229607130  81 TWIYTIARNLSYDLLRRQKGRDAYVLADDIWPEDYCPPDLVDHYAPEQDLLKEQVMKFLDRLPEAQQQVIKAVYLEEIPQ 160
gi 227082426  81 TWIYTIARNLSYDLLRRQKGRDAYVLADDIWPEDYCPPDLVDHYAPEQDLLKEQVMKFLDRLPEAQQQVIKAVYLEEIPQ 160
gi 262393473  94 TWIYTIIRNLCFDLLRKQKGKELHIHSDDIWPSEYYPPDLVDHYSPEQDMLKEQVVKFLDILPKNQRDVLQAVYLEELPH 173
                        170       180       190
                 ....*....|....*....|....*....|....
gi 15642300  161 QDVADMLDIPLGTVKSRLRLAVEKLRLSMDAESL 194
gi 161501819 164 QQVAEMFDIPLGTVKSRLRLAVEKLRHTMQADKL 197
gi 28899132  161 QQVAELFDIPLGTVKSRLRLAVEKLRHSMHTEQL 194
gi 37680783  164 QQVAEMFNIPLGTVKSRLRLAVEKLRHTMQADKL 197
gi 147673682 161 QDVADMLDIPLGTVKSRLRLAVEKLRLSMDAESL 194
gi 156975552 161 QQVAELFDIPLGTVKSRLRLAVEKLRHSMHTEQL 194
gi 229607130 161 QDVADMLDIPLGTVKSRLRLAVEKLRLSMDAESL 194
gi 227082426 161 QDVADMLDIPLGTVKSRLRLAVEKLRLSMDAESL 194
gi 262393473 174 QQVAELFDIPLGTVKSRLRLAVEKLRHSMHTEQL 207
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap