Conserved Protein Domain Family
PRK12547

?
PRK12547: PRK12547 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 139056
View PSSM: PRK12547
Aligned: 7 rows
Threshold Bit Score: 311.04
Threshold Setting Gi: 110635436
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49474607    1 MMEGVKDFKQELLLVLPALRAFAISLSSKHDKAEDLVQDTLMKAWAKQDSFEMGSNLKAWLFTILRNEFYSQMRKRGREV 80
gi 159186048   5 PEQTEYNFKREMLAALPNLRAFAISLIRSRDRADDLVQDTIMKAWAKQDSFQPGTNMRAWLVTILRNEFYSQIRKSGREV 84
gi 110635436   1 -MSASPSFRDGLLAAVPTLRAFAVSLAKNADRADDLVQETLVKAWDKQDSFQPGTNLKAWLFTILRNEFYSQMRKRRREV 79
gi 49476049    1 MAKSMKDFKQELLLILPSLRAFALSLSSKHDKAEDLVQDTLMKAWAKQDSFEMGTNLKAWLFTILRNEFYSQMRKRGREV 80
gi 13473184    1 MAAVSQGFKTDLLGAIPSLRAFAVSLTQNADKADDLVQETLVKAWDKHESFQPGTNLKAWLFTILRNEFYSQMRKRGREV 80
gi 163868952   1 MSKCAKNFKQELLVVLPALRAFAVSLSGKHDKAEDLVQDTVMKAWAKQDSFEMGTNLKAWLFTILRNEFYSQMRKKGREV 80
gi 240851087   1 MSKCAKNFKQELLLVLPALRAFAVSLSGKQDKAEDLVQDTVMKAWAKQDSFEMGTNLKAWLFTILRNEFYSQMRKKGREV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49474607   81 QDSDGVFIESVAIHPAQYGSLDLQDFKKALNMLSADQREAIILIGASGFSYEDAAAICGCAIGTIKSRVSRARNRLQELL 160
gi 159186048  85 QDTDGVYTSRLSVPPEQHGSVDLQDFRTALAKLPDDQREAILLIGASGFAYEEAAEICGCPVGTIKSRVSRARLRLQELL 164
gi 110635436  80 EDSDGSITARLSIHPAQEGNSDLNDFRRALALLPEDQREAIILIGASGFSYEEAAEICGCAVGTIKSRVSRARSRLQEIL 159
gi 49476049   81 QDSEGVFSENVAVHPPQYGSLDLQDFKKALNLLSADQREAIILIGASGFSYEDAAAICGCAVGTIKSRVSRARNRLQELL 160
gi 13473184   81 QDSDGIMTARLAVHPAQHGQLDLKDFRGALEQLPEDQREAIILIGASGFSYEEAAEICGCAVGTIKSRVSRARTRLQEIL 160
gi 163868952  81 QDTDGVFTQNVAVHPPQYGTLDLQDFKKALNLLSADQREAIILIGASGFSYEDAAAICGCAVGTIKSRVSRARHRLQELL 160
gi 240851087  81 QDTDGVFTQNVAVHPAQYGSLDLQDFKKALNLLSADQREAIILIGASGFSYEDAAAICGCAVGTIKSRVSRARNRLQELL 160

                 ....
gi 49474607  161 KVDR 164
gi 159186048 165 GIEN 168
gi 110635436 160 SISG 163
gi 49476049  161 KVDG 164
gi 13473184  161 KISG 164
gi 163868952 161 NVDG 164
gi 240851087 161 KVDG 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap