Conserved Protein Domain Family
PRK12551

?
PRK12551: PRK12551 
ATP-dependent Clp protease proteolytic subunit; Reviewed
Statistics
?
PSSM-Id: 139060
View PSSM: PRK12551
Aligned: 20 rows
Threshold Bit Score: 387.648
Threshold Setting Gi: 56750021
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33861299    1 MIPLVLEESGGSERVFDIYSRLLRERIIFLGEQVTSDTANRIVAQLLFLEAEDPEKDIYMYINSPGGSVYDGLGIFDTMQ 80
gi 33865835    1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEAVTSDSANRIVAQMLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMQ 80
gi 33862948    1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEPVTSDSANRIVAQMLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMQ 80
gi 78184632    1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEAVTSDSANRIVAQMLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMQ 80
gi 78212970   22 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEAVTSDSANRIVAQMLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMQ 101
gi 56750021    1 MIPIVVEESGRGERAFDIYSRLLRERIIFLGEPVTSDVANRIVAQLLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMN 80
gi 81300363    1 MIPIVVEESGRGERAFDIYSRLLRERIIFLGEPVTSDVANRIVAQLLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMN 80
gi 113953920   1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEPVTSDSANRIVAQLLFLEAEDPEKEIFLYVNSPGGSVYDGLGIFDTMQ 80
gi 124023248   1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEPVTSDSANRIVAQMLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMQ 80
gi 148239550   1 MIPIVIEESGRGERAFDIYSRLLRERIIFLGEAVTSESANRIVAQLLFLEAEDPEKDIFLYINSPGGSVYDGLGIFDTMQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33861299   81 HVKPDIHTVCVGLAASMGAFLLAAGTKGKRSSLRHSRIMIHQPLGGARGQASDIRIQADEILYLKERLNTELSERTGKEL 160
gi 33865835   81 HIKPDVHTVCVGLAASMGAFLLCAGTKGKRSSLQHSRIMIHQPLGGARGQASDIRIQADEILYLKERLNQELSDRTGQPL 160
gi 33862948   81 HVKPDVQTVCVGLAASMGAFLLCAGAMGKRSSLQHSRIMIHQPLGGARGQASDIRIQADEILFLKDRLNRVLADRTGQPL 160
gi 78184632   81 HIKPDVQTVCVGLAASMGAFLLCAGTKGKRSSLQHSRIMIHQPLGGASGQASDIRIQADEILYLKDRLNTELSDRTGQPL 160
gi 78212970  102 HIKPDVHTVCVGLAASMGAFLLCAGTKGKRSSLQHSRIMIHQPLGGAQGQASDIRIQADEILFLKERLNKELSDRTGQTL 181
gi 56750021   81 HIRPDVSTVCVGLAASMGAFLLAAGAKGKRTSLAHSRIMIHQPLGGAQGQAKDIEIQANEILYIKQNLNEVLAERTGQPL 160
gi 81300363   81 HIRPDVSTVCVGLAASMGAFLLAAGAKGKRTSLAHSRIMIHQPLGGAQGQAKDIEIQANEILYIKQNLNEVLAERTGQPL 160
gi 113953920  81 HIKPDVHTVCVGLAASMGAFLLCAGAKGKRSSLQHSRIMIHQPLGGASGQASDIRIQADEILFLKDRLNHELADRTGQPL 160
gi 124023248  81 HVKPDVQTVCVGLAASMGAFLLCAGAMGKRSSLQHSRIMIHQPLGGARGQASDIRIQADEILFLKDRLNRVLADRTGQPL 160
gi 148239550  81 HIKPDVQTVCVGLAASMGAFLLCAGAKGKRSSLRHSRIMIHQPLGGARGQASDIRIQADEILFLKNRLNQELSERTSQPL 160
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 33861299  161 ETIKGDTDRDFYMSPQEAVEYGLIDLVLDKKPVKNI 196
gi 33865835  161 DRIQQDTDRDFFMSPGEAVEYGLIDSVIDKRPIQAV 196
gi 33862948  161 ERIQEDTDRDFFMSPAEAVGYGLVDSVIDKRPVHSV 196
gi 78184632  161 DRIQEDTDRDFFMSPGEAVSYGLIDSVIDKRPVQAV 196
gi 78212970  182 DRIQQDTDRDFFMSPTEAMNYGLIDSVIDKRPVQAV 217
gi 56750021  161 SRIEDDTDRDFFMSASEAVEYGLIDRVIDRRALKAT 196
gi 81300363  161 SRIEDDTDRDFFMSASEAVEYGLIDRVIDRRALKAT 196
gi 113953920 161 DKIQADTDRDFFMSPQQAMEYGLIDNVIDKSPVRSV 196
gi 124023248 161 ERIQEDTDRDFFMSPTEAVGYGLVDSVIDKRPVHSV 196
gi 148239550 161 EKIQEDTDRDFFMSPNEAVDYGLIDSVIDKRPVHSV 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap