Conserved Protein Domain Family
PRK12559

?
PRK12559: PRK12559 
transcriptional regulator Spx; Provisional
Statistics
?
PSSM-Id: 79035
View PSSM: PRK12559
Aligned: 17 rows
Threshold Bit Score: 218.817
Threshold Setting Gi: 218898466
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30263362    1 MVVLYTTASCASCRKAKAWLEENQIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIEELSLNEFY 80 
42782476    1 MVVLYTTASCSSCRKAKAWLEENQIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIDELSLNEFY 80 
30021506    1 MVILYTTASCASCRKAKAWLEEHQIDYIEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIDELSLNEFY 80 
118478674   1 MVVLYTTASCSSCRKAKAWLEENKIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIDELSLNEFY 80 
217960814   1 MVVLYTTASCGSCRKAKAWLEENQIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIDELSLNEFY 80 
218231257   1 MVILYTTASCASCRKAKAWLEEHQIDYIEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIEELSLNEFY 80 
222096866   1 MVVLYTTASCGSCRKAKAWLEENQIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIEELSLNEFY 80 
227813769   1 MVVLYTTASCASCRKAKAWLEENQIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIEELSLNEFY 80 
225865370   1 MVVLYTTASCSSCRKAKAWLEENKIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIDELSLNEFY 80 
229602124   1 MVVLYTTASCASCRKAKAWLEENQIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIEELSLNEFY 80 
30263362   81 KLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN 131
42782476   81 TLIIEHPLMLRRPIMLDEKRLQIGFNEEEIRKFLPRSVRTFLNIELQKLAN 131
30021506   81 TLIIEHPLMLRRPIMLDEKRLQIGFNEEEIRKFLPRSVRTFLNIELQKLAN 131
118478674  81 KLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN 131
217960814  81 QLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN 131
218231257  81 TLIIEHPLMLRRPIMLDEKRLQIGFNEEEIRKFLPRSVRTFLNIELQKLAN 131
222096866  81 QLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN 131
227813769  81 KLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN 131
225865370  81 KLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN 131
229602124  81 KLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN 131
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap