Conserved Protein Domain Family
PRK12562

?
PRK12562: PRK12562 
ornithine carbamoyltransferase subunit F; Provisional
Statistics
?
PSSM-Id: 105755
View PSSM: PRK12562
Aligned: 9 rows
Threshold Bit Score: 702.586
Threshold Setting Gi: 157147747
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16128258    1 MSDLYKKHFLKLLDFTPAQFTSLLTLAAQLKADKKNGKEVQKLTGKNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPS 80
gi 91213809    1 MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEARLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPS 80
gi 26251161    1 MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEARLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPS 80
gi 146310124   1 MSELYKKHFLKLLDFTPAQVNSLLSLAAQLKADKKNGKEVQKLTGKNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPS 80
gi 157147747   1 MSTFYQKHFLKLLDFTSAELTALLQLAAKLKADKKNGVEVARLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPS 80
gi 170079897   1 MSDLYKKHFLKLLDFTPAQFTSLLTLAAQLKADKKNGKEVQKLTGKNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPS 80
gi 218692641   1 MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEARLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPS 80
gi 218702957   1 MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEARLTGKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPS 80
gi 296101045   1 MSDLYKKHFLKLLDFTPAQFTSLLTLAAQLKADKKNGKEVQKLTGKNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16128258   81 GSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAQYAGVPVWNGLTNEFHPTQLLADLMTMQEHLPGKAFNEMTLV 160
gi 91213809   81 GSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
gi 26251161   81 GSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
gi 146310124  81 GSQIGHKESIKDTARVLGRMYDGIQYRGHGQDVVETLAQYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKSFNEMALV 160
gi 157147747  81 GSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
gi 170079897  81 GSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAQYAGVPVWNGLTNEFHPTQLLADLMTMQEHLPGKAFNEMTLV 160
gi 218692641  81 GSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
gi 218702957  81 GSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
gi 296101045  81 GSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAQYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16128258  161 YAGDARNNMGNSMLEAAALTGLDLRLLAPKACWPEESLVAECSALAEKHGGKITLTEDVAAGVKGADFIYTDVWVSMGEA 240
gi 91213809  161 YAGDARNNMGNSMLEAAALTGLDLRLVAPQACWPEAALVAECSALAQKHGGKITLTEDIASGVKGADFIYTDVWVSMGEP 240
gi 26251161  161 YAGDARNNMGNSMLEAAALTGLDLRLVAPQACWPEAALVAECSALAQKHGGKITLTEDIASGVKGADFIYTDVWVSMGEP 240
gi 146310124 161 YAGDARNNMGNSMLEAAALLGLDLRLVAPKACWPEESLVAECSALALQNGGKITLTEDVAAGVKGADFIYTDVWVSMGEP 240
gi 157147747 161 YAGDARNNMGNSMLEAAALTGLDLRLVAPQACWPEASLVAECKALAQKNGGDITLTEDIAAGVKGADFIYTDVWVSMGEA 240
gi 170079897 161 YAGDARNNMGNSMLEAAALTGLDLRLLAPKACWPEESLVAECSALAEKHGGKITLTEDVAAGVKGADFIYTDVWVSMGEA 240
gi 218692641 161 YAGDARNNMGNSMLEAAALTGLDLRLVAPQACWPEAALVAECSALAQKHGGKITLTEDIASGVKGADFIYTDVWVSMGEP 240
gi 218702957 161 YAGDARNNMGNSMLEAAALTGLDLRLVAPQACWPEAALVAECSALAQKHGGKITLTEDIASGVKGADFIYTDVWVSMGEP 240
gi 296101045 161 YAGDARNNMGNSMLEAAALTGLDLRLVAPKACWPEESLVAECSALAQKHGGKITLTEDVAAGVKGADFIYTDVWVSMGEA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16128258  241 KEKWAERIALLRGYQVNAQMMALTDNPNVKFLHCLPAFHDDQTTLGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENR 320
gi 91213809  241 KEKWAERIALLRDYQVNSKMMALTGNSQVKFLHCLPAFHDEQTTLGKKMAAEFGLYGGMEVTDEVFESPASIVFDQAENR 320
gi 26251161  241 KEKWAERIALLRDYQVNSKMMALTGNSQVKFLHCLPAFHDEQTTLGKKMAAEFGLYGGMEVTDEVFESPASIVFDQAENR 320
gi 146310124 241 KEKWAERIALLRGYQVNSEMMALTGNPNVKFLHCLPAFHDDHTALGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENR 320
gi 157147747 241 KEKWAERIALLRQYQVNSAMMAQTGNPQVKFLHCLPAFHDDQTTLGKKMAEEFGLHGGMEVTDAVFESPASIVFDQAENR 320
gi 170079897 241 KEKWAERIALLRGYQVNAQMMALTDNPNVKFLHCLPAFHDDQTTLGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENR 320
gi 218692641 241 KEKWAERIALLRDYQVNSKMIALTGNSQVKFLHCLPAFHDEQTTLGKKMAAEFGLYGGMEVTDEVFESPASIVFDQAENR 320
gi 218702957 241 KEKWAERIALLRDYQVNSKMMALTGNSQVKFLHCLPAFHDEQTTLGKKMAAEFGLYGGMEVTDEVFESPASIVFDQAENR 320
gi 296101045 241 KEKWAERIALLRGYQVNAQMMALTGNPNVKFLHCLPAFHDDQTTLGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENR 320
                        330
                 ....*....|....
gi 16128258  321 MHTIKAVMMATLGE 334
gi 91213809  321 MHTIKAVMVATLAK 334
gi 26251161  321 MHTIKAVMVATLAK 334
gi 146310124 321 MHTIKAVMVATLGK 334
gi 157147747 321 MHTIKAVMVATLAK 334
gi 170079897 321 MHTIKAVMMATLGE 334
gi 218692641 321 MHTIKAVMVATLAK 334
gi 218702957 321 MHTIKAVMVATLAK 334
gi 296101045 321 MHTIKAVMVATLGG 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap