Conserved Protein Domain Family
PRK12568

?
PRK12568: PRK12568 
glycogen branching enzyme; Provisional
Statistics
?
PSSM-Id: 139075
View PSSM: PRK12568
Aligned: 9 rows
Threshold Bit Score: 1339.98
Threshold Setting Gi: 190574677
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21229886    1 MAEGGGGSavALQDLQAIAAGLPGDAFAVLGPHVQADGRLRVRVLAPGAEALGLIDGRGKLLARMQASPIDGVFEGELPA 80
gi 84621722   17 VTTEGISE--MSQTLQALADGLPVDAFAVLGPHPLADGRRQVRVLAPGAEAMGLIDSRGKLLARMQASAIDGVFEGILSI 94
gi 78046008   17 MTTEGISE--TSQTLQALANGLPADAFAVLGPKPLAEGRRQVRVLAPGAEAMGLIDPRGKLLARMQASAIDGVFEGILAA 94
gi 122878984   1 MTTEGISE--MSQTLQALADGLPVDAFAVLGPHPLADGRRQVRVLAPGAEAMGLIDSRGKLLARMQASAIDGVFEGILSI 78
gi 66766764    1 MAEGGGGSavALQDLQAIAAGLPGDAFAVLGPHVQADGRLRVRVLAPGAEALGLIDGRGKLLARMQASPIDGVFEGELPA 80
gi 77748524    1 MTTEGISE--MSQTLQALADGLPADAFAVLGPKLLADGRRQVRVLAPGAEAMGLIDPRGKLLARMQASAIDGVFEGTLAV 78
gi 188574381   1 MTTEGISE--MSQTLQALADGLPVDAFAVLGPHPLADGRRQVRVLAPGAEAMGLIDSRGKLLARMQASAIDGVFEGILSI 78
gi 188989837  16 MAEGGGGSavALQDLQAIAAGLPGDAFAVLGPHVQADGRLRVRVLAPGAEALGLIDGRGKLLARMQASPIDGVFEGELPA 95
gi 190574677  16 MATAGREEgvVAPVLDDLVHARPADAFAWLGPHQQPDGQRQLRVLVPHARRVEVIAGPERRWD-LQPGPLPGLFEGAAGE 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21229886   81 DAAYRLRIVWPDVVQEIEDPYAFAPQIDESALLQIGAGDGQALRANLGARHVQVGELPAVRFAVWAPHAQRVAVVGDFNG 160
gi 84621722   95 EGPYRLRIVWPDMVQEIEDPYAFAVTLDESLLLQIAAGDGQALRRALGAQHVQCGEVPGVRFAVWAPHAQRVAVVGDFNG 174
gi 78046008   95 DGPYRLRIVWPDRVQEVEDPYAFAATLDESLLLQIAAGDGQAVRRALGAQHVHCGDVPGVRFAVWAPHAQRVAVVGDFNG 174
gi 122878984  79 EGPYRLRIVWPDMVQEIEDPYAFAVTLDESLLLQIAAGDGQALRRALGAQHVQCGEVPGVRFAVWAPHAQRVAVVGDFNG 158
gi 66766764   81 DAAYRLRIVWPDVVQEIEDPYAFAPQIDESALLQIGAGDGQALRANLGARHVQVGELPAVRFAVWAPHAQRVAVVGDFNG 160
gi 77748524   79 DGPYRLRIVWPDRVQEVEDPYAFAATLDESLLLQIAAGDGQALRRALGAQHLHCGDVPGVRFALWAPHAQRVAVVGDFNG 158
gi 188574381  79 EGPYRLRIVWPDMVQKIEDPYAFAVTLDESLLLQIAAGDGQALRRALGAQHVQCGEVPGVRFAVWAPHAQRVAVVGDFNG 158
gi 188989837  96 EAAYRLRIVWPDVVQEIEDPYAFAPQIDESALLQIAAGDGQALRANLGARHVQVGEVPTVRFAVWAPHAQRVAVVGDFNG 175
gi 190574677  95 APVPLLALHFEQGVEQVHDAYSFGPLLDEALLQHFHAGDADAARQ-LGAVAMQVQGIDGVRFAVWAPNARRVAVVGDFNG 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21229886  161 WEPRRHPMRQR-SGGIWELVLPRVETGARYKYAIITADGRVLL-KADPVARQSELPPATASVVASADAFAWTDAEWMARR 238
gi 84621722  175 WDVRRHPMRQR-IGGFWELFLPRVEAGPRYKYAVTAADGRVLL-KADPVARQTELPPATASVVPGTDTFAWTDAAWMAKR 252
gi 78046008  175 WDVRRHPMRQR-IGGFWELFLPRVEAGARYKYAVTAADGRVLL-KADPVARQTELPPATASVVPSAAAFAWTDAAWMANR 252
gi 122878984 159 WDVRRHPMRQR-IGGFWELFLPRVEAGPRYKYAVTAADGRVLL-KADPVARQTELPPATASVVPGTDTFAWTDAAWMAKR 236
gi 66766764  161 WEPRRHPMRQR-SGGIWELVLPRVETGARYKYAIITADGRVLL-KADPVARQSELPPATASVVASADAFAWTDAEWMARR 238
gi 77748524  159 WDVRRHPMRQR-IGGFWELFLPRVDAGARYKYAVTAADGRVLL-KADPVARQTELPPATASVVPSAATFAWTDAAWMANR 236
gi 188574381 159 WDVRRHPMRQR-IGGFWELFLPRVEAGPRYKYAVTAADGRVLL-KADPVARQTELPPATASVVPGTATFAWTDAAWMAKR 236
gi 188989837 176 WEPRRHPMRQR-SGGIWELVLPRVETGARYKYAITTADGRVLL-KADPVARQSELPPATASVVASADAFAWTDAEWMARR 253
gi 190574677 174 WDGRRHPMRLRhTAGVWELFLPGVQAGARYKFRIVGADGRVMPdKFDPMARWAELPPATASRVPSAAPMQWHDDAWLAAR 253
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21229886  239 SAAAEPAPLSIYEVHAASWRRDGHDQPLDWVSLAAQLIPYVQELGFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 318
gi 84621722  253 DPSAVPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLRFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 332
gi 78046008  253 DPGAVPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLGFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 332
gi 122878984 237 DPSAVPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLRFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 316
gi 66766764  239 SAAAEPAPLSIYEVHAASWRRDGHDQPLDWVSLAAQLIPYVQELGFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 318
gi 77748524  237 DPAAVPGPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLGFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 316
gi 188574381 237 DPSAVPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLRFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 316
gi 188989837 254 SAAAEPAPLSIYEVHAASWRRDGHDQPLDWVSLAAQLIPYVQELGFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSP 333
gi 190574677 254 RQAGTCTPLSIYEVHAGSWQRSDDGSPLDWDVLADRLIPYVAGLGFTHIELLPVSEHPFGGSWGYQPLGIYAPTARHGTP 333
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21229886  319 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLSQFDGSATYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSAMEWIA 398
gi 84621722  333 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWID 412
gi 78046008  333 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWIE 412
gi 122878984 317 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWID 396
gi 66766764  319 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLSQFDGSATYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSAMEWIA 398
gi 77748524  317 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWIE 396
gi 188574381 317 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWID 396
gi 188989837 334 DGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLSQFDGSATYEHADPREGMHRDWNTLIYNYGRPEVTAYLLGSAMEWIA 413
gi 190574677 334 QAFARFVDRCHQAGIGVIVDWVSAHFPNDAHGLAGFDGTALYEHADPREGVHADWDTLIYNYGRNEVAAYLIGSALEWVE 413
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21229886  399 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLTGEIASQFPGVLTIAEESTAWPGVTAPISEGGL 478
gi 84621722  413 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNREIAAHFPGVLTIAEESTAWPGVTAAISDGGL 492
gi 78046008  413 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNREIATQFPGVLTIAEESTAWPGVTAAISDGGL 492
gi 122878984 397 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNREIAAHFPGVLTIAEESTAWPGVTAAISDGGL 476
gi 66766764  399 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLTGEIASQFPGVLTIAEESTAWPGVTAPISEGGL 478
gi 77748524  397 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNRDIATQFPGVLTIAEESTAWPGVTAAISDGGL 476
gi 188574381 397 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLNREIAAHFPGVLTIAEESTAWPGVTAAISDGGL 476
gi 188989837 414 HYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQLTGEIASQFPGVLTIAEESTAWPGVTAPISEGGL 493
gi 190574677 414 RFHIDGLRVDAVASMLYRDYSRAEGQWIPNEQGGRENLQAVAFLRRMNQTLRERFPDVLVIAEESTAWPGVTAPVEQGGL 493
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21229886  479 GFTHKWNMGWMHDTLHYMQRDPAARAQHHSQLTFGLVYAFSERFVLPLSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 558
gi 84621722  493 GFTHKWNMGWMHDTLSYMQRDPAERAHHHSQLTFGLVYAFDERFVLPISHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 572
gi 78046008  493 GFTHKWNMGWMHDTLGYMQRDPAERAQHHSQLTFGLVYAFDERFVLPLSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 572
gi 122878984 477 GFTHKWNMGWMHDTLSYMQRDPAERAHHHSQLTFGLVYAFDERFVLPISHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 556
gi 66766764  479 GFTHKWNMGWMHDTLHYMQRDPAARAQHHSQLTFGLVYAFSERFVLPLSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 558
gi 77748524  477 GFTHKWNMGWMHDTLGYMQRDPAERAHHHSQLTFGLVYAFDERFVLPLSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 556
gi 188574381 477 GFTHKWNMGWMHDTLSYMQRDPAERAHHHSQLTFGLVYAFDERFVLPISHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 556
gi 188989837 494 GFTHKWNMGWMHDTLHYMQRDPAARAQHHSQLTFGLVYAFSERFVLPLSHDEVVHGTGGLLGQMPGDDWRRFANLRAYLA 573
gi 190574677 494 GFTHKWNMGWMHDTLQYLGRDPVHRQHHHSEISFGLVYAFSERFVLPLSHDEVVHGKGALLAKMAGEPVQRLAQLRAYYG 573
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21229886  559 LMWAHPGDKLLFMGAEFGQWADWNHDRSLDWHLLDHAPHRGMQQLVRDLNRALRRVPALYRGNHRADGFEWSVADDARNS 638
gi 84621722  573 LMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLEGARHRGVQLLVGDLNATLRRTPALYRGTHRAKGFDWSVADDARNS 652
gi 78046008  573 LMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLDGARHRGMQQLVGDLNAALRRTPALYRGSHRADGFDWSVADDARNS 652
gi 122878984 557 LMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLEGARHRGVQLLVGDLNATLRRTPALYRGTHRAKGFDWSVADDARNS 636
gi 66766764  559 LMWAHPGDKLLFMGAEFGQWADWNHDRSLDWHLLDHAPHRGMQQLVRDLNRALRRVPALYRGNHRADGFEWSVADDARNS 638
gi 77748524  557 LMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLDGARHRGMQQLVGDLNAALRRTPALYRGTHRAEGFDWSVADDARNS 636
gi 188574381 557 LMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLEGARHRGVQLLVGDLNATLRRTPALYRGTHRAEGFDWSVADDARNS 636
gi 188989837 574 LMWAHPGDKLLFMGAEFGQWADWNHDRSLDWHLLDHAPHRGMQQLVRDLNRALRRVPALYRGNHRADGFEWSVADDARNS 653
gi 190574677 574 FMWAHPGSKLLFMGGEFGQGQEWSHDAALDWVQAASNEGQGLSRLVGDLNAVLRAEPALHRDERDERGFDWSVADDSRNS 653
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21229886  639 VLAFIRHDPDGGA-PLLAVSNLTPQPHHDYRVGVPRAGGWREILNTDSAHYGGSNLGNGGRLLTEPTGMHGHAQSLRLTL 717
gi 84621722  653 VLAFIRHDPDGGGvPLLAVSNLTAQPLHDYGVGVPRAGAWREILNTDSAHYGGSNLGNSGRLATEPMGMHGHAQRLRLTL 732
gi 78046008  653 VLAFVRHDPAGGA-PLLAVSNLTPQPHHDYHVGVPRAGLWREILNTDSAHYGGSNLGNSGRLATEPVGMHGHAQRLRLTL 731
gi 122878984 637 VLAFIRHDPDGGGvPLLAVSNLTAQPLHDYGVGVPRAGAWREILNTDSAHYGGSNLGNSGRLATEPMGMHGHAQRLRLTL 716
gi 66766764  639 VLAFIRHDPDGGA-PLLAVSNLTPQPHHDYRVGVPRAGGWREILNTDSAHYGGSNLGNGGRLLTEPTGMHGHAQSLRLTL 717
gi 77748524  637 VLAFVRHDPDGGA-PLLAVSNLTPQPHHDYHVGVPRAGLWREILNTDSAHYGGSNLGNSGRLATEPVGMHGHAQRLRLTL 715
gi 188574381 637 VLAFIRHDPDGGGvPLLAVSNLTAQPLHDYGVGVPRAGAWREILNTDSAHYGGSNLGNSGRLATEPMGMHGHAQRLRLTL 716
gi 188989837 654 VLAFIRHDPDGGA-PLLAVSNLTPQPHHDYRVGVPRAGGWREILNTDSAHYGGSNLGNGGRLLTEPTGMHGHAQSLRLTL 732
gi 190574677 654 VYAFIRRDPAGSGrTLLVVSNFTPVRRDGYRVGVPQPGCWTERLNTDSGYYGGGNAGNLGAVHTEPRPMHGHAQSLRLTL 733
                        730
                 ....*....|..
gi 21229886  718 PPLATIYLQAEK 729
gi 84621722  733 PPLATIYLQAEK 744
gi 78046008  732 PPLATIYLQAEK 743
gi 122878984 717 PPLATIYLQAEK 728
gi 66766764  718 PPLATIYLQAEK 729
gi 77748524  716 PPLATIYLQAEK 727
gi 188574381 717 PPLATIYLQAEK 728
gi 188989837 733 PPLATIYLQAEK 744
gi 190574677 734 PPLSTLYLQVDA 745
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap