Conserved Protein Domain Family
PRK12596

?
PRK12596: PRK12596 
putative monovalent cation/H+ antiporter subunit E; Reviewed
Statistics
?
PSSM-Id: 105779
View PSSM: PRK12596
Aligned: 11 rows
Threshold Bit Score: 308.44
Threshold Setting Gi: 153010855
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17989112    1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80
gi 23500250    1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80
gi 62317633    1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80
gi 83269616    1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80
gi 148558073   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80
gi 163844664   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALESQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80
gi 161620567   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80
gi 153010855   1 MKKILPYPLLFASLLLFWLLLNGFTRAQLLLGAIIALVACLIMTALQPQKNHIRSIPTMLLLFGTMSYDILQSNIAVAGI 80
gi 189022884   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80
gi 225686299   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80
gi 256015283   1 MKKILPYPLLFVSLVLFWLLLNSFTRAQFILGLVIAFGACRVMMALEPQKNHIRSPRMMIWLLYAASIDVLRSNIAVVRL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17989112   81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
gi 23500250   81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
gi 62317633   81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
gi 83269616   81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
gi 148558073  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
gi 163844664  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
gi 161620567  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
gi 153010855  81 ILSRKRKRRPGFVVIQLDLENRTALAVLACIITATPGTAWVDYNAARHELTIHVLDLDDAQAWRDTIKGRYEQPLIKIFG 160
gi 189022884  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
gi 225686299  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
gi 256015283  81 ILSPGRQRHPGFVVIPLELQNRTALAVLACMITASPGTAWVDYNAARGILTIHVLDLEDAETWRHLIKERYERPLIEIFG 160
                        170
                 ....*....|.
gi 17989112  161 VVDIVEGEKSA 171
gi 23500250  161 AVDIVEGEKSA 171
gi 62317633  161 AVDIVEGEKSA 171
gi 83269616  161 AVDIVEGEKSA 171
gi 148558073 161 AVDIVEGEKSA 171
gi 163844664 161 AVDIVEGEKTA 171
gi 161620567 161 AVDIVEGEKSA 171
gi 153010855 161 AADVMEEEKSA 171
gi 189022884 161 AVDIVEGEKSA 171
gi 225686299 161 VVDIVEGEKSA 171
gi 256015283 161 AVDIVEGEKSA 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap