Conserved Protein Domain Family
flgB

?
PRK12624: flgB 
flagellar basal body rod protein FlgB; Provisional
Statistics
?
PSSM-Id: 139107
View PSSM: PRK12624
Aligned: 6 rows
Threshold Bit Score: 253.836
Threshold Setting Gi: 189910284
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45656203    1 MFEKTHFMKTQDLLERGMNNSIFKRKVISDNIANADVPHFKRSEVIFESMIKRAIESEKIEAIKEVPTQISDERHIQFFK 80
gi 24213047    1 MFEKTHFMKTQDLLERGMNNSIFKRKVISDNIANADVPHFKRSEVIFESMIKRAIESEKIEAIKEVPTQISDERHIQFFK 80
gi 189910284   1 MFEATHFMKTQDLLERGLGAATQRRKVITDNIANADVPNFKRSEVVFESMLKRAIESEKIEKEKAVPTKISNDRHIEFFK 80
gi 183220164   1 MFEATHFMKTQDLLERGLGAATQRRKVITDNIANADVPNFKRSEVVFESMLKRAIESEKIEKEKAVPTKISNDRHIEFFK 80
gi 116327146   1 MFEKTHFMKTQDLLERGMNNSILKRKVISDNIANADVPHFKRSEVIFESMIKRAIESEKIETLKEVPTQISDERHIQFFK 80
gi 116332197   1 MFEKTHFMKTQDLLERGMNNSILKRKVISDNIANADVPHFKRSEVIFESMIKRAIESEKIETLKEVPTQISDERHIQFFK 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 45656203   81 PLDYREVQPKANTDYLTTMRADGNNVDVEKEVVEASNSQMQYMMMAERINQNYRELKQVMRMA 143
gi 24213047   81 PLDYREVQPKANTDYLTTMRADGNNVDVEKEVVEASNSQMQYMMMAERINQNYRELKQVMRMA 143
gi 189910284  81 PLDYRDAKPKTNLDYLTTMRPDGNNVDIEKEVVEANQNQMSYSLMIDRLNQNNRLLNIVMRTN 143
gi 183220164  81 PLDYRDAKPKTNLDYLTTMRPDGNNVDIEKEVVEANQNQMSYSLMIDRLNQNNRLLNIVMRTN 143
gi 116327146  81 PLDYREVQPKTNIDYLTTMRADGNNVDVEKEVVEASNSQMQYMIMTERLNQNYRDLKQVMRMA 143
gi 116332197  81 PLDYREVQPKTNIDYLTTMRADGNNVDVEKEVVEASNSQMQYMIMTERLNQNYRDLKQVMRMA 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap