Conserved Protein Domain Family
flgC

?
PRK12628: flgC 
flagellar basal body rod protein FlgC; Provisional
Statistics
?
PSSM-Id: 79089
View PSSM: PRK12628
Aligned: 5 rows
Threshold Bit Score: 265.937
Threshold Setting Gi: 54294161
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54294161    1 MSLNAIFDIAASAMTAETVRLTTSAGNMSNANVEAGSPDEVYQAKYPVFKSVQENANQWMGEQIKAGVKLDGIYESDAEP 80
gi 54297180    1 MSLNAIFDIAASAMTAETVRLTTSAGNMSNANVEAGSPDEVYQAKYPVFKSVQENANQWIGEQIKAGVKLDGIYQSDAEP 80
gi 148358804   1 MSLNAIFDIAASAMTAETVRLTTSAGNMSNANVEAGSPDEVYQAKYPVFKSVQENANQWMGEQIKAGVKLDGIYESDAEP 80
gi 296106849   1 MSLNAIFDIAASAMTAETVRLTTSAGNMSNANVEAGSPDEVYQAKYPVFKSVQENANQWMGEQIKAGVKLDGIYESDAEP 80
gi 52841449    1 MSLNAIFDIAASAMTAETVRLTTSAGNMSNANVEAGSPDEVYQAKYPVFKSVQENANQWMGEQIKAGVKLDGIYESDAEP 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 54294161   81 HRRYDPNSPIADKDGFVYTSNINYVEEMANIISASRSYQMNIELLNTTKQLMQRTLQLGE 140
gi 54297180   81 HRRYDPNSPIADKDGFVYTSNINYVEEMANIISASRSYQMNIELLNTTKQLMQRTLQLGE 140
gi 148358804  81 HRRYDPNSPIADKDGFVYTSNINYVEEMANIISASRSYQMNIELLNTTKQLMQRTLQLGE 140
gi 296106849  81 HRRYDPNSPIADKDGFVYTSNINYVEEMANIISASRSYQMNIELLNTTKQLMQRTLQLGE 140
gi 52841449   81 HRRYDPNSPIADKDGFVYTSNINYVEEMANIISASRSYQMNIELLNTTKQLMQRTLQLGE 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap