Conserved Protein Domain Family
flgF

?
PRK12641: flgF 
flagellar basal body rod protein FlgF; Reviewed
Statistics
?
PSSM-Id: 105809
View PSSM: PRK12641
Aligned: 5 rows
Threshold Bit Score: 309.18
Threshold Setting Gi: 161511182
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219681700   1 MENSIYKSMIAANQLLEKQSIISNNLANISTTGFKEKFIFAIQNHNVKNLYNSDKKIT-KEYYNLSPGILRYTGRNLD-L 78 
161485722   1 MNKAIYESMNAAIKLLDKQAVIANNLANISTVGFKESFNLFIKDRNLQNLKKTYNQNV-KEYYNFYPGTLIHTQRNLD-L 78 
28952051    1 MENSIYKSMIAANQLLEKQSIISNNLANISTTGFKEKFIFAIQNHNVKNLYNSDKKIT-KEYYNLSPGILRYTGRNLD-L 78 
219682255   1 MENSIYKSMIAANQLLEKQSIISNNLANISTTGFKEKFIFAIQNHNVKNLYNSDKKIT-KEYYNLSPGILRYTGRNLD-L 78 
161511182   1 MESIVNAIITSTNKIFENQARIANNITNISTPGFKSELELKILLPSQKDQNSQEDNFLyKQYKNKNQGTLRRTNQPLDcA 80 
219681700  79 FIKDDGWLTVKDTNGQEAYTKNGHLKINSKRKLTIQDNEVIGNNCNIIIPKNIILKILSNGVITSVKNKHKHIVETKIGS 158
161485722  79 VIKNNGWLAIKDINGQEAYTKNGHIKINKEGKMTVQNYELIGNNGNIKIPNNVNLKISSNGIIKEIKKNKDSIIESTIGS 158
28952051   79 FIKDDGWLTVKDTNGQEAYTKNGHLKINSKRKLTIQDNEVIGNNCNIIIPKNIILKILSNGVITSVKNKHKHIVETKIGS 158
219682255  79 FIKDDGWLTVKDTNGQEAYTKNGHLKINSKRKLTIQDNEVIGNNCNIIIPKNIILKILSNGVITSVKNKHKHIVETKIGS 158
161511182  81 IIDKNDWFVIKIDPKTIAYTKNGHFKINSNRQLTVQNHPVLGEDGEIFIPKNENIVISSDGYINIIKNN---VLQHKVAQ 157
219681700 159 LKLVQLPSQDLIQNENGLFYLKKNneiNKKHTNTIKHSKKIRVQSGMLEESNVNASKNMIEMISNARQFEMQMKMISMCD 238
161485722 159 LKLVRLQNDNLIQKENGLFYLKKD---NLNKYKNILHDSSVRIQSEMLEASNVNPTKNMIDMISNARQFEMNMKIISMCD 235
28952051  159 LKLVQLPSQDLIQNENGLFYLKKNneiNKKHTNTIKHSKKIRVQSGMLEESNVNASKNMIEMISNARQFEMQMKMISMCD 238
219682255 159 LKLVQLPSQDLIQNENGLFYLKKNneiNKKHTNTIKHSKKIRVQSGMLEESNVNASKNMIEMISNARQFEMQMKMISMCD 238
161511182 158 FKLKNFDINDLTYKTNGLYLLNKNnklNHTNHKNV---SNIKLVSGILEDSNVNLEENMVEMISNARKFDMQIKILSMYN 234
219681700 239 QNAEYANQLININN 252
161485722 236 QNTEYANQLFNVNN 249
28952051  239 QNAEYANQLININN 252
219682255 239 QNAEYANQLININN 252
161511182 235 ENTQAASRFLNLNY 248
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap