Conserved Protein Domain Family
PRK12687

?
PRK12687: PRK12687 
flagellin; Reviewed
Statistics
?
PSSM-Id: 105853
View PSSM: PRK12687
Aligned: 4 rows
Threshold Bit Score: 384.402
Threshold Setting Gi: 27381977
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381976    2 GSSLLTNSSAMTALQTLRNVSTQLATTQNRISTGQRVSTASDNSAYWSIATSMRSDNAALSAVSDSLGLSAAMVDTEYTA 81
gi 27381977    1 MSSLLTNSTAMTALQTLRSVSSQLSTTQTRISTGQRVSTASDNAAYWSIATSMRSDNAALSAVSDSLGLSAATVDTEYTA 80
gi 115523186   1 MSSLMTNTSAMTALQTLRNVNSSLATTQNRISTGYRVATASDNSAYWSIATTMRSDNEALSAVSDALGLGAATVDTMYTA 80
gi 90422617    1 MSSLLTNTSAMTALQTLRNVSSSLATTQNRISTGYRVATASDNSAYWSIATTMRSDNEALSAVSDALGLGAATVDTMYTA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381976   82 LNTVIGDKNSGLTKLQALLVEAKTAGIDRTKIQAEVTQIQQDMKLKSDSATINGINWLSIDITPSSSTATPTtfnLVSSY 161
gi 27381977   81 LNTVIGDKDSGLTKLQALLVEAKTAGIDRSKIQADVTQIQNQLKSTADSATINGINWLSIDTTPSSSTATPTsfnLVSSY 160
gi 115523186  81 LTSVVGDSKGGLTALKAKLVAAREPGIDRTKIQSEITAIQADLKNTAGLAVFNGENWLAVDSSAASYNATKS---VVSSF 157
gi 90422617   81 LTSVVGDSKSGLTALKAKLVAAREPGVDRVKVQSEITAIQDDLKNTAGLAVFNGENWLSVDSSVTGYNATKS---VVSSF 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381976  162 SRVGGTPTIGSITVTTATYALYTTGGSSTTGILD-TVVGGSTGASVASINIGALTDSATDQTKLDGYINQVTAAINSVAS 240
gi 27381977  161 SRVGNTPTIGSITVTTATYALYTTGGSSTTGILD-AVVGGSTGASVSSINIGALTDSATDQTKLDGYIAQVTAAIGSVAS 239
gi 115523186 158 TRVGGAVAVKTIDINISKLSLYDSNGA--IGILDkSVTVGTATASVSSIDIHLLTDNATDLAILDGMIGIVDQALGSVTQ 235
gi 90422617  158 TRVGGTVAIKTIDVNIDKLKLYDPNGGTPAGIMDkTVTVGTATDAVSTIDIHLLTDSAADLTKLDGLIGIVDQALGSVTQ 237
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27381976  241 AAANLGAVKNRIATNTEFVKNLMDSVDRGIGQLVDADMNAESTRLQALQTQQQLGVQALSIANQNSQSILSLFR 314
gi 27381977  240 AAANLGAVKNRISTNTEFVKNLMDSVDRGVGQLVDADMNQESTRLAALQVQQQLGVQALSIANNSSQSILSLFR 313
gi 115523186 236 ASADLGATKTRIDSNSNFVKSLRDAIDRGIGQLVDADMNAESTRLQALQTQQQLGIQALSIANQGSQSILSLFK 309
gi 90422617  238 ASADLGATKTRIDSNSNFIKSLRDAIDRGVGQLVDADMNAESTRLQALQTQQQLGIQALSIANSGSQSILSLFK 311
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap