Conserved Protein Domain Family
flgG

?
PRK12692: flgG 
flagellar basal body rod protein FlgG; Reviewed
Statistics
?
PSSM-Id: 139158
View PSSM: PRK12692
Aligned: 11 rows
Threshold Bit Score: 489.358
Threshold Setting Gi: 188579867
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158422258   1 MRALAIAATGMNAQQTNVEVIANNIANINTTGFKRARAEFSDLLYQSERTQGIPNRDGGQAIPEGAMLGLGVRTVGIRNL 80
gi 27381984    1 MKSLAIAATGMNAQQTNIEVIANNIANINSTSYKRARAEFTDLFYQMDRMQGVANVNGSSPIPEGANLGLGVKSAAIRKL 80
gi 170741836   1 MRALAIAATGMNAQQLNLEVIANNVANLNTTGFKGARAEFTDLLYQAERQQGVPNQTGQEAVPEGALLGLGVRAAAIRNL 80
gi 240137197   1 MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGVPNQAGQEAVPEGAMLGLGVRAAAIRNL 80
gi 163850063   1 MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGVPNQAGQEAVPEGAMLGLGVRAAAIRNL 80
gi 254559209   1 MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGVPNQAGQEAVPEGAMLGLGVRAAAIRNL 80
gi 170748107   1 MRALAIAATGMNAQQLNVEVIANNISNLNTTAFKAARAEFKDLIYQAERPAGVPIQAGESAIPEGAMLGLGVRNTAIRNL 80
gi 218528666   1 MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGVPNQAGQEAVPEGAMLGLGVRAAAIRNL 80
gi 188579867   1 MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLYQAERQQGAPNQAGQEAVPEGAMLGLGVRAAAIRNL 80
gi 115523179   1 MRSLAIAATGMSAQQLNVEVIANNIANINTTSYKRSRAEFTDLFYQIDRMQGVPNRVGEGAVPEGAKLGLGVRSAAVRKL 80
gi 90422610    1 MRALAIAATGMSAQQLNVEVIANNIANINTTSYKRARAEFTDLFYQIDRMQGVPNRVGEGAVPEGAKLGLGVRSAAVRKL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158422258  81 HTQGPLTQTGNTLDLAVNGRGMFEITTPDGQTVYTRAGSFNRSATGQLVTSDGYVINPAIQFPNNATEIQVNESGQVYAT 160
gi 27381984   81 HIQGALTQTGNPYDLAINGRGWFQVLGPNNEVQYTRAGSFNTNANSQLVTTDGYLLDPAITIPQGTVEVTVNQTGQVFAK 160
gi 170741836  81 HRQGPLAQTSNNLDLAINGRGYFQVTNPNGEVNYTRAGSFNKSSTGQLVTLEGYVVEPAILFPANTVDVVINQSGQVYAK 160
gi 240137197  81 HRQGSLANTGNQLDLAVNGRGYFQITSPAGEIQYTRAGSFNKNNAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAK 160
gi 163850063  81 HRQGSLANTGNQLDLAVNGRGYFQITSPAGEIQYTRAGSFNKNNAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAK 160
gi 254559209  81 HRQGSLANTGNQLDLAVNGRGYFQITSPAGEIQYTRAGSFNKNNAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAK 160
gi 170748107  81 HRQGPLNNTTNPLDLAINGRGWFQVTMPNGEINYTRAGSFNKNADGRLVTAEGYSVDPAIIIPQNAIDVVINETGQVMVK 160
gi 218528666  81 HRQGSLANTGNQLDLAVNGRGYFQITSPAGEIQYTRAGSFNKNNAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAK 160
gi 188579867  81 HRQGSLANTGNQLDLAVNGRGYFQITSPAGEINYTRAGSFNKNNAGQLVTMEGYAVDPAILIPANTTQVTINESGQVFAK 160
gi 115523179  81 HLQGALAQTGNAYDLAVNGRGWFQVVGPNGDTLYTRAGAFNTNADAQLVTADGYKVDPTILIPEGTAQVTVNESGQVYAK 160
gi 90422610   81 HLQGALTQTGNPYDLAVNGRGWFQVVGPNGETLYTRAGAFNTNADGQLVTADGYNVDPAILIPQGTVEVTVNESGQVFAK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158422258 161 IPNQTNPQLLGQLTLVNFANESGMEPLGNNLYRETLASGQPIVGVAGDVGFGKIQQGYLEASNVDPVKEITELIAAQRSY 240
gi 27381984  161 LDTEVNPRQIGQLNLANFANEAGLEPLGSNLYRETTASGTPVVGLPGDAGYGKINQKYLEASNVDPVKEITELISAQRAY 240
gi 170741836 161 VDGQATPQLLGQLSIANFANESGLEPLGNGLYRETAASGAPVTGVAGDTGFGKVQQGYLESSNVDPVKEITSLITAQRAF 240
gi 240137197 161 IDGQVALQNVGQLTLANFANDSGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRAF 240
gi 163850063 161 IDGQVALQNVGQLTLANFANDSGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRAF 240
gi 254559209 161 IDGQVALQNVGQLTLANFANDSGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRAF 240
gi 170748107 161 VDGQQLPQTIGQLQLANFTNDAGLEPLGNGLYRETAASGLPVTGFAADPGFGKIQQGYLETSNVDPVREITNLISAQRAF 240
gi 218528666 161 IDGQVALQNVGQLTLANFANDSGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRAF 240
gi 188579867 161 TDGQVALQNIGQLTLANFANESGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGSNVDPVKEITSLITAQRAF 240
gi 115523179 161 LDTEVTPRLLGQLTLANFANEAGLDPLGSNLYKETIASGTPVVGFPGDIGFGKIHQHYLESSNVDPVKEITELISAQRSY 240
gi 90422610  161 LDGEITPRELGRLTLANFANEAGLDPLGSNLYKETLSSGVPVVGVPGDPGFGKIYHHYLESSNVDPVKEITELISAQRSY 240
                        250       260
                 ....*....|....*....|..
gi 158422258 241 EMNSKVIQAADEMSKTVSTGIR 262
gi 27381984  241 EMNAKVIQASDEMASTVSKGLR 262
gi 170741836 241 EMNSKVIQAADEMAGTVSKGIR 262
gi 240137197 241 EMNSKVIQAADEMAGTVSKGIR 262
gi 163850063 241 EMNSKVIQAADEMAGTVSKGIR 262
gi 254559209 241 EMNSKVIQAADEMAGTVSKGIR 262
gi 170748107 241 EMNSKVIQAADEMAGTISKGIR 262
gi 218528666 241 EMNSKVIQAADEMAGTVSKGIR 262
gi 188579867 241 EMNSKVIQAADEMAGTVSKGIR 262
gi 115523179 241 EMNSKVIQAADEMASTISKGLR 262
gi 90422610  241 EMNSKVITAADEMAQTVSKGLR 262
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap