Conserved Protein Domain Family
flgH

?
PRK12699: flgH 
flagellar basal body L-ring protein; Reviewed
Statistics
?
PSSM-Id: 105864
View PSSM: PRK12699
Aligned: 3 rows
Threshold Bit Score: 386.603
Threshold Setting Gi: 82702456
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162219162   1 MKQSSCFDAINQRLLGTLISPVLIVMVSMVTGCSMiTPAPKVQQPMTIRPPEPLIIPVSQSNGGIYQAAFNYQGSGRYTP 80
gi 30248325   20 DGQCSGVMESFMRNRGHLVLPVLIVMICVVSGCAI-TPTPKVQQPMSVRPPDLPVIPPSQTSGGIYQAVFDYQGRGRYIP 98
gi 82702456    1 -----MVLSFSAKRRARVLGFMTGVPLALSGCVSLpPPAPIVHQPMSARAA---LPAPPPGNGAVYQDA------NQYHS 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162219162  81 LFEDRRARGIGDTIIVMLNEKTNASKKSGSNAQRDGGIDLSVPSF-LGLPFKSIFQDLDLEAKSSNKFDGKGESSSNNNF 159
gi 30248325   99 LFEDRRARSIGDTIIVALNEKTNASKKTGSNAQRAGEIGLSVPSF-LGLPFKSIFQDLDLEATSSNKFDGKGESSSNNNF 177
gi 82702456   67 LFIDRRARQIGDTLVILLTERTNASKRSNSSANKNGDVSFGIPPIvFGVP---ITKKIDLGASSSNDFAGKGEAASANNF 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 162219162 160 TGTITVTVIDILPNGNLLVSGEKQIGINQGHEFIRLSGVINPINVMNNTVSSVQVADARIEYRGTGYLDEAQTMGWLSRF 239
gi 30248325  178 TGTIAVTVLDILPNGNLLVSGEKQIGINQGHEFIRLSGVINPINIINNTVSSIQVADARIEYRGNGYLDEVQTMGWLSRF 257
gi 82702456  144 SGTITVTVVDVLPNSYLVVSGEKQLAMTQGSEYIRFSGVVRPETVISNTVSSIQVADARIEYKANGYIDEAQTMGWLSRF 223

                 ....*..
gi 162219162 240 FLSISPF 246
gi 30248325  258 FLSISPF 264
gi 82702456  224 FLTVAPF 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap