Conserved Protein Domain Family
flgH

?
PRK12700: flgH 
flagellar basal body L-ring protein; Reviewed
Statistics
?
PSSM-Id: 139164
View PSSM: PRK12700
Aligned: 5 rows
Threshold Bit Score: 360.909
Threshold Setting Gi: 163856438
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33601544    1 MMLKTVLRLPVCAALLALAAGCAMIPPEPVVTGPLTAPPPPPPQPSARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIV 80
gi 33596142    1 MMLKTVLRLPVCAALLALAAGCAMIPPEPVVTGPLTAPPPPPPQPSARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIV 80
gi 33592482    1 -MLKTVLRLPVCAALLALAAGCAMIPPEPVVICPLTAPPPSPPQPSARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIV 79
gi 187478188   1 VMLKTVARL-MSGLLLILSAGCALIPPEPVVIGPTTAAPPMPAAPAGRPNGSIYQPTAYGNYPLFEDRRPRNVGDIVTVM 79
gi 163856438   1 ---MIVLRLLFAAVLALAAAGCAMIPPEPVVTGPVTAAPPPPPMPAAQPNGSIYQPRVYGNYPLFEDRRPRNVGDIVTIV 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33601544   81 LEEKTNAAKGVATNTSRDGSATLGVAAAPRFMDGIINDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQ 160
gi 33596142   81 LEEKTNAAKGVATNTSRDGSATLGVAAAPRFMDGVINDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQ 160
gi 33592482   80 LEEKTNAAKGVATNTSRDGSATLGVAAAPRFMDGIINDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQ 159
gi 187478188  80 LEEKTNAAKGVATNTSRSGGAKLGVAAAPKFMDGVVNNKLDTDITGDNTAKGTGNSSANNSFTGSITTTVVGVLPNGNLQ 159
gi 163856438  78 LNERTNAAKNVATNTDRSGNVGLGIAATPGFMDSWANAKLNTDASGSNKASGKGDSSANNTFTGTITTTVIGVLPNGNLQ 157
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33601544  161 IAGEKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEVQTMGWLQRFFLIASPF 230
gi 33596142  161 IAGEKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEVQTMGWLQRFFLIASPF 230
gi 33592482  160 IAGEKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEVQTMGWLQRFFLIASPF 229
gi 187478188 160 IAGEKQIAINRGSEYVRLSGVVDPRSITGTNSVSSTRVADARIEYRSKGVMDEVQTMGWLQRFFLIASPF 229
gi 163856438 158 VAGEKQIAINRGSEYVRFSGVVDPRSITGANSVSSTQVADARIEYRSKGVMDEVQTMGWLQRFFLIASPF 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap