Conserved Protein Domain Family
PRK12702

?
PRK12702: PRK12702 
mannosyl-3-phosphoglycerate phosphatase; Reviewed
Statistics
?
PSSM-Id: 105866
View PSSM: PRK12702
Aligned: 2 rows
Threshold Bit Score: 586.655
Threshold Setting Gi: 86609826
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
86606457   1 MRLVLSSLDGSLLDPQSNSYGAARQALAALERRSIPLVLYSLRTRTQLEHLCRQLRLEHPFICEDGSAIYVPEHYFPAGI 80 
86609826   1 MRLVLTSLDGSLLDLEFNSYGAARQALAALERRSIPLVLYSLRTRAQLEHVRRQLRLEHPFICEDGSAVYVPEHYFPAGI 80 
86606457  81 LDERWQHRPPYYVCALGLPYPCLRHILQQVRQDYHLDLIGFGDWTASELAAATGIPLEEAERVQKREYSEIFSYSGDPAR 160
86609826  81 LDEQWQHRPPYYVYALGLPYSRLRSILQQVRQESHLDLIGFGDWTASELAAATGIPLEEAERAQQREYSEIFSYSGDPET 160
86606457 161 LREALAQQEATLTQHLLRLHQLHFSDPSRWYLTGWRRTTLTSEPSSLPGEQAVRLLLDCYQRHLGPVRALGIGCSPPDLA 240
86609826 161 LREAFAQQEANLTQHLLRVRQLHFSSLPQWYLTGWMQPTMAAEPNWLPGEQAVQRLLDCYQRHLGPIKALGIGCSPPDVA 240
86606457 241 FLRWVERKVVLPSPIADSLWKEAVrlggpevqTQWQLARLPGPEGWNEVVLRWLEETDHGDE 302
86609826 241 FLRWSEQKVVLPSPIADSLWSEAL--------PQWQLAQLPGPEGWNEVVLMWLEETDHGDE 294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap