Conserved Protein Domain Family
flgJ

?
PRK12710: flgJ 
flagellar rod assembly protein/muramidase FlgJ; Provisional
Statistics
?
PSSM-Id: 139170
View PSSM: PRK12710
Aligned: 5 rows
Threshold Bit Score: 526.668
Threshold Setting Gi: 148358811
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54294168    1 MTIQSIATSDFQGLNELKVQAKNNAKEALPEVAKQFEGIFLQSMLKSMRMGLHFLDESSPFSGKNEATFQEMLDTQYAST 80
gi 54297187    1 MTIQSIATSDFQGLNELKIQAKNNAKEALPEVAKQFEGIFLQSMLKSMRMGQHFLDESSPFSGENEATFQEMLDAQYAST 80
gi 148358811   1 MTIQSIATSDFQGLNELKVQAKNNAKEALPEVAEQFEGIFLQSMLKSMRMGQHFLDESSPFSGKNEATFQEMLDTQYAST 80
gi 296106856   1 MTIQSIATSDFQGLNELKVQAKNNAKEALPEVAEQFEGIFLQSMLKSMRMGQHFLDESSPFSGKNEATFQEMLDTQYAST 80
gi 52841456    4 MTIQSIATSDFQGLNELKIQAKNNAKEALPEVAKQFEGIFLQSMLKSMRMGQHFLDESSPFSGKNEATFQEMLDAQYAST 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54294168   81 IAESKGIGLAALLAKQLENSVGDKANNPVNSSTEVSNTKVTNSEESLSVVDDFVKSVWPTAKQAALLIGLDPKLLVAQAA 160
gi 54297187   81 IAESKGIGLAALLAKQLENSVGYKANSLDNSSAEVNNTKVTNSEESISVVDDFVKSVWPTAKKAASLIGLDPKLLMAQAA 160
gi 148358811  81 IAESKGIGLAALLAKQLENSVGDKANNPVNSSTEVSNTKVTNSEESLSVVDDFVKSVWPTAKQAASLIGLDPKLLVAQAA 160
gi 296106856  81 IAESKGIGLAALLAKQLENSVGDKANNPVNSSTEVSNTKVTNSEESLSVVDDFVKSVWPTAKQAASLIGLDPKLLVAQAA 160
gi 52841456   84 IAESKGIGLAALLAKQLENSVGDKANKPVNSSTEVNNTKVTNSEESLSVVDDFVKSVWPTAKQAASLIGLDPKLLVAQAA 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54294168  161 LETGWGKFVTRDADGSSSNNLFNIKTGSHSEVESIQVKTTEYIADTPIKINASFRKYPSIEHSFHDYISLIKGSERYQMA 240
gi 54297187  161 LETGWGKFVTRDADGSSSNNLFNIKTGSHSEVESIQVKTTEYIADTPIKINASFRKYPSIEHSFHDYVSLIRGSERYQMA 240
gi 148358811 161 LETGWGKFVTRDTDGSSSNNLFNIKAGSHSEVESIQVKTTEYIADTPIKINASFRKYPSIEHSFHDYVSLIKGSERYQMA 240
gi 296106856 161 LETGWGKFVTRDTDGSSSNNLFNIKAGSHSEVESIQVKTTEYIADTPIKINASFRKYPSIEHSFHDYVSLIKGSERYQMA 240
gi 52841456  164 LETGWGRFVTRDADGSSSNNLFNIKTGSHSEVESIQVKTTEYIADTPIKINASFRKYPSIEHSFHDYVSLIKGSERYQMA 243
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 54294168  241 LANAENPEIYVSELNKAGYATDPNYSNKILSIYHGDELNQAIQRCESSEQS 291
gi 54297187  241 LANAANPEIYVSELNKAGYATDPNYSNKILSIYHGDELNQAIQRCELSEQS 291
gi 148358811 241 LANAENPEIYVSELNKAGYATDPNYSNKILSIYHGDELNQAIQRCESSEQS 291
gi 296106856 241 LANAENPEIYVSELNKAGYATDPNYSNKILSIYHGDELNQAIQRCESSEQS 291
gi 52841456  244 LANAENPEIFVSELNKAGYATDPNYSNKILSIYHGDELNQAIQRCESFEQS 294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap