Conserved Protein Domain Family
flgJ

?
PRK12712: flgJ 
flagellar rod assembly protein/muramidase FlgJ; Provisional
Statistics
?
PSSM-Id: 139172
View PSSM: PRK12712
Aligned: 4 rows
Threshold Bit Score: 607.773
Threshold Setting Gi: 73539455
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188592122   6 NGGALPAAGADLTQRFALDTQGFEALKHSARGGADANTLHAVAKQFEAVFTQMVLKSMRDATPQDGLFDNEQSKLYLSMM 85
gi 116694224   1 MNTARPPQAAELTQRFALDTQGFEALKHSARGGADANTLQAVARQFEAVFTQMVLKSMRDATPQDGLFDNEQSKLYMSMM 80
gi 94312674    1 MTGATLSGQSDISQRFALDTQGFEALKNQARAGNNSGSLQAAARQFEAVFTNMVLKSMRDATPSDGLFDNEQTKLYMSMM 80
gi 73539455    1 -MDSALSAQADVSQRFALDTQGFEALKQSARSGADTGTLRAAAKQFEAVFTQMVLKSMRDATPQDGVFDSEQGKLYMSML 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188592122  86 DQQLAQQMSSRGIGLADVMVRQLARATGTAMPSGM---NALTPAEAGNAADAEMARLLDSRGAGAMSADAAeqaDLPAIG 162
gi 116694224  81 DQQLAQQMSSRGIGLADVMVRQLARATGTPMPAGM---SAMSPAESGKAADAEMARLLDSRGAGAIPADAGeqaDLPAIG 157
gi 94312674   81 DQQLSQQLSTRGIGLADVMIRQLARATGQQLPPNM---ATAGGVTAASIQDAQMAGLLDGRGATDADGPAL------PVG 151
gi 73539455   80 DQQLAQQMSSRGIGLAEVMVRQLARATGAQVPPGMisaNAAPGATGTAAADAEMARLLDGRGAGAATAQDG---DAPAIG 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188592122 163 TIVAGQQWNPTAGLRQYQPQSYA--DRGQGEDRLGRLPDDAPAHVSAFVARMAGPAEAASRASGVPARLIVGQAALESGW 240
gi 116694224 158 TIVPGQNWNPTAGLRQYQPQWYA--DRGQGEDRLGRLPDDAPSHVSAFVARMAGPAEAAARASGVPARLIVGQAALESGW 235
gi 94312674  152 TTLPGPAWNPTAGVRQYQNQADW---QGNGQAQLGQLPNDTPEHISSFVNRMAGPAMVASRASGVPAKLIVGQAALESGW 228
gi 73539455  157 TVVPGASWNPTAGLRQYREQDYAwqGQGQGGSNLGPLPDDAPAHVSAFVSRMSAPAEAASRVSGVPARLIVGQAALESGW 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188592122 241 GQREITHADGSTTFNVFGIKAGPSWKGRVAEITTTEYIDGQPQKVRAKFRAYGSYDEACADYARLLTSNPRYAGVVSAAN 320
gi 116694224 236 GQREITHADGSTTFNVFGIKAGASWKGRVAEITTTEYVDGQPQKVRAKFRAYGSYDEACADYARLLTNNPRYAGVVSAAS 315
gi 94312674  229 GRREILNSDGSTSFNVFGIKAGANWKGPTTEVLTTEYVDGQPQKVRARFRAYGSYEEACNDYARLLTSNPRYAGVVAANS 308
gi 73539455  237 GRREITHPDGSTTFNVFGIKAGANWKGRVAEVTTTEYVDGQPQKVRARFRAYGSYDEACADYARLLTTNPRYAAVVSAGS 316
                        330       340       350
                 ....*....|....*....|....*....|..
gi 188592122 321 AEDAAHGLQRAGYATDPSYGHKLVKIMKKVAA 352
gi 116694224 316 AEEAAHGLQRAGYATDPAYGHKLVKIMKKVAA 347
gi 94312674  309 ADEAAHGLQRAGYATDPAYGEKLVRIMKKVST 340
gi 73539455  317 ADEAAHGLQRAGYATDPAYGQKLVQIMKKVSA 348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap