Conserved Protein Domain Family
flgJ

?
PRK12713: flgJ 
flagellar rod assembly protein/muramidase FlgJ; Provisional
Statistics
?
PSSM-Id: 139173
View PSSM: PRK12713
Aligned: 4 rows
Threshold Bit Score: 601.734
Threshold Setting Gi: 33592484
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33592484    1 MSFVSYTSRPGVQESVFDLGRLADLKRDAVKAPDGQRQQTEVARQFEALFLQMMLKRMREATPKEGLFDSQQTEMLQGMA 80
gi 33601546    1 MSFVSYTPRPGVQESVFDLGRLADLKRDAVKAPDGQRQQTEVARQFEALFLQMMLKRMREATPKEGLFDSQQTEMLQGMA 80
gi 33596144    1 MSFVSYTPRPGVQESVFDLGRLADLKRDAVKAPDGQRQQTEVARQFEALFLQMMLKRMREATPKEGLFDSQQTEMLQGMA 80
gi 187478190   1 MALTSNLAGAQPQDSVFDLGRLGNLKRGVGQNPADAAQQKEVAQQFEALFLQMMLKRMREATPKDGLFDSQQTEMLQSMS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33592484   81 DEQLALQLASPDIGLAQALLGQMQQGQPPVPAAAAAGGDAAAARALAGTAAPAPLVRDLRGNYVQPDPAPRREVNALLDV 160
gi 33601546   81 DEQLALQLASPGIGLAQALLGQMQQGQPPVPAAAAAGGDAAAARALAGTAAPAPLVRDLRGNYVQPDPAPRREVNALLDV 160
gi 33596144   81 DEQLALQLASPGIGLAQALLGQMQQGQPPVPAAAAAGGDAAAARALAGTAAPAPLVRDLRGNYVQPDPAPRREVNALLDV 160
gi 187478190  81 DEQMALQLAKPGVGLADALLKQMQQQNP----TPAQAGDEATANAVAGK--PPRLMRDQYGRYVQQ---PEGGVAALLNV 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33592484  161 LRSNRARDRAMAAAEGAPSHVVDFVSRMSRAANVAAQQSGVPARLILGQAALESGWGRRELRHEDGSTSYNLFGIKAGAS 240
gi 33601546  161 LRSNRARDRAMAAAEGAPSHVVDFVSRMSRAANVAAQQSGVPARLILGQAALESGWGRRELRHEDGSTSYNLFGIKAGAS 240
gi 33596144  161 LRSNRARDRAMAAAEGAPSHVVDFVSRMSRAANVAAQQSGVPARLILGQAALESGWGRRELRHEDGSTSYNLFGIKAGAS 240
gi 187478190 152 LRNNRPVDRAFAAAEGAPDHVVDFVSRMSRAANAAAAESGVPARLILGQAALESGWGKREIRQPDGSTSYNLFGIKAGAG 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33592484  241 WKGKVVNVMTTEYVDGVAQKLVQSFRAYSSYEESFSDYARLIGNSPRYEaAVTQAGNEIEAARRIQEAGYATDPRYAEKL 320
gi 33601546  241 WKGKVVNVMTTEYVDGVAQKLVQPFRAYSSYEESFSDYARLIGNSPRYE-AVTQAGNEIEAARRIQEAGYATDPRYAEKL 319
gi 33596144  241 WKGKVVNVMTTEYVDGVAQKLVQPFRAYSSYEESFSDYARLIGNSPRYE-AVTQAGNEIEAARRIQEAGYATDPRYAEKL 319
gi 187478190 232 WKGRVVHVLTTEYVDGVPQKVSQPFRAYNSYEESFADYARLVGGSARYE-TVAQASNETEAAHRIQRSGYATDPRYAEKL 310
                        330       340
                 ....*....|....*....|
gi 33592484  321 ISIMGQLRTSVARADFSGGL 340
gi 33601546  320 ISIMGQLRTSVARADFSGGL 339
gi 33596144  320 ISIMGQLRTSVARADFSGGL 339
gi 187478190 311 IKIMSQLRASVAQADFSGSP 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap