Conserved Protein Domain Family
flgL

?
PRK12718: flgL 
flagellar hook-associated protein FlgL; Provisional
Statistics
?
PSSM-Id: 79176
View PSSM: PRK12718
Aligned: 3 rows
Threshold Bit Score: 945.009
Threshold Setting Gi: 33596146
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33592486   1 MRLSTALIYQNGLNGVLNQEAAMARLQEQLSSGRRVLTPADDPLAAALAINVSQTSSMNSNYDANRKQAEQALGAQTNTL 80
gi 33596146   1 MRLSTALIYQNGLNGVLNQEAAMARLQEQLSSGRRVLTPADDPLAAALAVNVSQTSSMNSNYDANRKQAEQALGAQTNTL 80
gi 33601548   1 MRLSTALIYQNGLNGVLNQEAAMARLQEQLSSGRRVLTPADDPLAAALAVNVSQTSSMNSNYDANRKQAEQALGAQTNTL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33592486  81 QSVVKNMQEMLKRVVEAGNGTMSDADRQALVIALKGAREELVGLANATDGNGQYLFSGYKGFTQPYSFDAATGKVTYNGD 160
gi 33596146  81 QSVVKNMQEMLKRVVEAGNGTMSDADRQALVIALKGAREELVGLANATDGNGQYLFSGYKGFTQPYSFDAATGKVTYNGD 160
gi 33601548  81 QSVVKNMQEMLKRVVEAGNGTMSDADRQALVIALKGAREELVGLANATDGNGQYLFSGYKGFTQPYSFDAATGKVTYNGD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33592486 161 LGQRGIQVDQSRLMSGGDVGSDIFNSVTSGTLAYIADAGAGNTGTGQYSAVSFDGPRAGNYVGRDFRIEFTRDAVTDELQ 240
gi 33596146 161 LGQRGIQVDQSRLMSGGDVGSDIFNSVTSGTLAYIADAGAGNAGTGQYSAVSFDGPRAGNYVGRDFRIEFTRDAVTDELQ 240
gi 33601548 161 LGQRGIQVDQSRLMSGGDVGSDIFNSVTSGTLAYIADAGAGNAGTGQYSAVSFDGPRAGNYVGRDFRIEFTRDAVTDELQ 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33592486 241 YSVLSDPPVVPPEQPLPANMPYSEGSVIDMNGVSIKLSGQPEAGDVFTVETPKSWKMGVQGDAANTGSATLTPVSLPDGL 320
gi 33596146 241 YSVLSDPPVVPPEQPLPANMPYSEGSVIDMNGVSIKLSGQPEAGDVFTVETPKSWKMGVQGDAANTGSATLTPVSLPDGL 320
gi 33601548 241 YSVLSDPPVVPPEQPLPANMPYSEGSVIDMNGVSIKLSGQPEAGDVFTVETPKSWKMGVQGDAANTGSATLTPVSLPDGL 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33592486 321 TGKNLSVAFLDDGAGGLLYSVTSTPPDPSLPANVPVKPGDVIDIGGLKVKVDGQPAAGDTYAVTTPKSANVDVFDTLNDL 400
gi 33596146 321 TGKNLSVAFLDDGAGGLLYSVTSTPPDPSLPANVPVKPGDVIDIGGLKVKVDGQPAAGDTYAVTTPKSANVDVFDTLNDL 400
gi 33601548 321 TGKNLSVAFLDDGAGGLLYSVTSTPPDPSLPANVPVKPGDVIDIGGLKVKVDGQPAAGDTYAVTTPKSANVDVFDTLNDL 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33592486 401 IGALDTPISGDPQAAAALANTLATANKKLNLSLDNVLTVQASVGARLNELEALGNTGAQKVLSYVKQLSDLEDVNIYQAT 480
gi 33596146 401 IGALDTPISGDPQAAAALANTLATANKKLNLSLDNVLTVQASVGARLNELEALGNTGAQKGLSYVKQLSDLEDVNIYQAT 480
gi 33601548 401 IGALDTPISGDPQAAAALANTLATANKKLNLSLDNVLTVQASVGARLNELEALGNTGAQKGLSYVKQLSDLEDVNIYQAT 480
                       490       500       510
                ....*....|....*....|....*....|
gi 33592486 481 SDLLLRQVALQAASLALQRIQGNSLFSMGR 510
gi 33596146 481 SDLLLRQVALQAASLALQRIQGNSLFSMGR 510
gi 33601548 481 SDLLLRQVALQAASLALQRIQGNSLFSMGR 510
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap