Conserved Protein Domain Family
PRK12759

?
PRK12759: PRK12759 
bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional
Statistics
?
PSSM-Id: 139206
View PSSM: PRK12759
Aligned: 9 rows
Threshold Bit Score: 830.824
Threshold Setting Gi: 134301991
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156502403   1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDIKRAEFYAEVNKNILLVEEHIRTIPQIFVGDIHIGGYDNLMAR 80
gi 89256330    1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDIKRAEFYAEVNKNILLVEEHIRTIPQIFVGDIHIGGYDNLMAR 80
gi 115314778   1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDIKRAEFYAEVNKNILLVEEHIRTIPQIFVGDIHIGGYDNLMAR 80
gi 56707665    1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMAR 80
gi 110670136   1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMAR 80
gi 167627842   1 MVEVKIYTKTNCPFCDLAKSWFGTNDIPFTQITLDDDQERLNFYAEVNKNILLVEEHIKSVPQIFIGDVPIGGYDNLMAR 80
gi 134301991   1 MVKVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMAR 80
gi 118497575   1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMAR 80
gi 187931834   1 MVEVRIYTKTNCPFCDLAKSWFGANDIPFTQISLDDDVKRAEFYAEVNKNILLVEEHIRTVPQIFVGDVHIGGYDNLMAR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156502403  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
gi 89256330   81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
gi 115314778  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
gi 56707665   81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
gi 110670136  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
gi 167627842  81 AGEVIARVKGSSLTTFSKTYKPFSYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
gi 134301991  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
gi 118497575  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
gi 187931834  81 AGEVIARVKGSSLTTFSKTYKPFNYPWAVDLTVKHEKAHWIEDEIDLSEDVTDWKNGKITKVEKEYITNILRLFTQSDVA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156502403 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
gi 89256330  161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
gi 115314778 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
gi 56707665  161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
gi 110670136 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
gi 167627842 161 VGQNYYDQFIPLFKNNEVRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDANPNTRRGLGLC 240
gi 134301991 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
gi 118497575 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
gi 187931834 161 VGQNYYDQFIPLFKNNEIRNMLGSFAAREGIHQRAYALLNDTLGLPDSEYHAFLEYKAMTDKIDFMMDADPTTRRGLGLC 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156502403 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
gi 89256330  241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
gi 115314778 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
gi 56707665  241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
gi 110670136 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
gi 167627842 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNQFKKEIYLMASKAV 320
gi 134301991 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
gi 118497575 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
gi 187931834 241 LAKTVFNEGVALFASFAMLLNFQRFGKMKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAV 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156502403 321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
gi 89256330  321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
gi 115314778 321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
gi 56707665  321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
gi 110670136 321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
gi 167627842 321 ELEDKFIDLAYEIGTIEGLKADEVKEYIRHITDRRLNQLGLNEIYNIDKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
gi 134301991 321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
gi 118497575 321 ELEDKFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
gi 187931834 321 ELEDRFIELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNFFENRVTEYEVAGL 400
                        410
                 ....*....|
gi 156502403 401 TGSWDEAYSA 410
gi 89256330  401 TGSWDEAYSA 410
gi 115314778 401 TGSWDEAYSA 410
gi 56707665  401 TGSWDEAYSA 410
gi 110670136 401 TGSWDEAYSA 410
gi 167627842 401 TGNWDEAYQH 410
gi 134301991 401 TGSWDEAYSA 410
gi 118497575 401 TGSWDEAYSA 410
gi 187931834 401 TGSWDEAYSA 410
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap