Conserved Protein Domain Family
fliQ

?
PRK12781: fliQ 
flagellar biosynthesis protein FliQ; Reviewed
Statistics
?
PSSM-Id: 139219
View PSSM: PRK12781
Aligned: 6 rows
Threshold Bit Score: 99.5296
Threshold Setting Gi: 170744549
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 188579931  1 MNEVDALELVRSAIWTVLVAAGPSVGAAMLVGIAVALLQALTQVQEVTLTFVPKIVAILLVMLVTGTFVGSQIYAFAEMT 80
gi 170744549  1 MNEVDALELVRAAIWTILIGAGPAVAAAMAVGIAVALLQALTQIQEVTLTFVPKIVVILLVMLMTGSFVGTQLYMFTENA 80
gi 115523199  1 MNERDALDIAQQAVWTIIVASGPAVAAAMFVGIAIALLQALTQVQEMTLTFIPKIVVMLIVVAVSGSFMGAHIYAFTELL 80
gi 90422630   1 MNERDALDIVQQAIWTIIVVSGPAVGAAMAVGVAIALLQALTQVQEMTLTFIPKIVVMLIVVAVSGSFMGAHIYAFTELL 80
gi 170748119  1 MNEIDALELVRSAIWTIIVASGPAVGAAMVVGILIALFQALTQIQEVTLTFVPKIVVVLIVMIVTGSFVGGQIYAFTEMV 80
gi 27381963   1 MNERDALDIVQAAIWTIIVASGPAVGAAMLVGTIIALIQALTQIQEVTLTFVPKIIVILVVVAISGSFIGAHLSTFTEMV 80

                ....*...
gi 188579931 81 YGRIATGF 88
gi 170744549 81 YGRITSGF 88
gi 115523199 81 YSRIEHGF 88
gi 90422630  81 YSRIEHGF 88
gi 170748119 81 YGRIVSGF 88
gi 27381963  81 YSHIERGF 88
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap